Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197987_WB13.jpg WB (Western Blot) (Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:GRIK2Submitted by:Anonymous)

Rabbit GRIK2 Polyclonal Antibody | anti-GRIK2 antibody

GRIK2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GRIK2; EAA4; GLR6; MRT6; GLUK6; GLUR6; GluK2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GRIK2, Antibody; GRIK2 antibody - N-terminal region; anti-GRIK2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLK
Sequence Length
908
Applicable Applications for anti-GRIK2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:GRIK2Submitted by:Anonymous)

product-image-AAA197987_WB13.jpg WB (Western Blot) (Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:GRIK2Submitted by:Anonymous)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA197987_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-GRIK2 antibody
This is a rabbit polyclonal antibody against GRIK2. It was validated on Western Blot and immunohistochemistry

Target Description: The GRIK2 gene encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.
Product Categories/Family for anti-GRIK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
Glutamate receptor ionotropic, kainate 2
NCBI Official Synonym Full Names
glutamate ionotropic receptor kainate type subunit 2
NCBI Official Symbol
GRIK2
NCBI Official Synonym Symbols
EAA4; GLR6; MRT6; GLUK6; GLUR6; GluK2
NCBI Protein Information
glutamate receptor ionotropic, kainate 2
UniProt Protein Name
Glutamate receptor ionotropic, kainate 2
UniProt Gene Name
GRIK2
UniProt Synonym Gene Names
GLUR6; GluK2; EAA4; GluR-6; GluR6
UniProt Entry Name
GRIK2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GRIK2 grik2 (Catalog #AAA197987) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIK2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRIK2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GRIK2 grik2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDFSSLSRAI LDLVQFFKWK TVTVVYDDST GLIRLQELIK APSRYNLRLK. It is sometimes possible for the material contained within the vial of "GRIK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.