Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198199_WB13.jpg WB (Western Blot) (WB Suggested Anti-GRIK5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysateGRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit GRIK5 Polyclonal Antibody | anti-GRIK5 antibody

GRIK5 Antibody

Gene Names
GRIK5; KA2; EAA2; GRIK2; GluK5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GRIK5, Antibody; GRIK5 Antibody; anti-GRIK5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
Sequence Length
980
Applicable Applications for anti-GRIK5 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GRIK5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GRIK5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysateGRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198199_WB13.jpg WB (Western Blot) (WB Suggested Anti-GRIK5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysateGRIK5 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Rabbit Anti-GRIK5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Membrane in cell processesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198199_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-GRIK5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Membrane in cell processesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GRIK5 antibody
This is a rabbit polyclonal antibody against GRIK5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GRIK5 is a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. GRIK5 forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108kDa
NCBI Official Full Name
glutamate receptor ionotropic, kainate 5 isoform 2
NCBI Official Synonym Full Names
glutamate ionotropic receptor kainate type subunit 5
NCBI Official Symbol
GRIK5
NCBI Official Synonym Symbols
KA2; EAA2; GRIK2; GluK5
NCBI Protein Information
glutamate receptor ionotropic, kainate 5
UniProt Protein Name
Glutamate receptor ionotropic, kainate 5
UniProt Gene Name
GRIK5
UniProt Synonym Gene Names
GRIK2; GluK5; EAA2; KA2
UniProt Entry Name
GRIK5_HUMAN

Similar Products

Product Notes

The GRIK5 grik5 (Catalog #AAA198199) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIK5 Antibody reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRIK5 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GRIK5 grik5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDGLYGAPEP NGSWTGMVGE LINRKADLAV AAFTITAERE KVIDFSKPFM. It is sometimes possible for the material contained within the vial of "GRIK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.