<
WB (Western Blot)
(WB Suggested Anti-GSN Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Rabbit GSN Polyclonal Antibody | anti-GSN antibody
GSN antibody - C-terminal region
Gene Names
GSN; ADF; AGEL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GSN, Antibody; GSN antibody - C-terminal region; anti-GSN antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
Sequence Length
782
Applicable Applications for anti-GSN antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GSN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-GSN Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
WB (Western Blot)
(WB Suggested Anti-GSN Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
WB (Western Blot)
(GSN antibody - C-terminal region validated by WB using pFA fixed human tonsil tissue)
WB (Western Blot)
(GSN antibody - C-terminal region validated by WB using pFA fixed human tonsil tissue)
IHC (Immunohiostchemistry)
(IHC Information: Paraffin embedded tonsil tissue, tested with an antibody Dilution of 5 ug/ml.)
IHC (Immunohiostchemistry)
(IHC Information: Paraffin embedded tonsil tissue, tested with an antibody Dilution of 5 ug/ml.)
IHC (Immunohistochemistry)
(GSN antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm and membrane of pneumocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(GSN antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm and membrane of pneumocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GSN antibody
This is a rabbit polyclonal antibody against GSN. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GSN binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. It is a calcium-regulated protein, which functions in both assembly and disassembly of actin filaments. Defects in the gene encoding GSN are a cause of familial amyloidosis Finnish type (FAF).The protein encoded by this gene binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
Target Description: GSN binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. It is a calcium-regulated protein, which functions in both assembly and disassembly of actin filaments. Defects in the gene encoding GSN are a cause of familial amyloidosis Finnish type (FAF).The protein encoded by this gene binds to the 'plus' ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.
Product Categories/Family for anti-GSN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
gelsolin isoform a
NCBI Official Synonym Full Names
gelsolin
NCBI Official Symbol
GSN
NCBI Official Synonym Symbols
ADF; AGEL
NCBI Protein Information
gelsolin
UniProt Protein Name
Gelsolin
UniProt Gene Name
GSN
UniProt Synonym Gene Names
ADF
UniProt Entry Name
GELS_HUMAN
Similar Products
Product Notes
The GSN gsn (Catalog #AAA200349) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSN antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GSN can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GSN gsn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KPMIIYKGGT SREGGQTAPA STRLFQVRAN SAGATRAVEV LPKAGALNSN. It is sometimes possible for the material contained within the vial of "GSN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.