Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199567_WB13.jpg WB (Western Blot) (WB Suggested Anti-HAVCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

Rabbit anti-Dog, Human HAVCR2 Polyclonal Antibody | anti-HAVCR2 antibody

HAVCR2 antibody - N-terminal region

Gene Names
HAVCR2; TIM3; CD366; KIM-3; TIMD3; Tim-3; TIMD-3; HAVcr-2
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HAVCR2, Antibody; HAVCR2 antibody - N-terminal region; anti-HAVCR2 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP
Sequence Length
301
Applicable Applications for anti-HAVCR2 antibody
WB (Western Blot)
Homology
Dog: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HAVCR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HAVCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

product-image-AAA199567_WB13.jpg WB (Western Blot) (WB Suggested Anti-HAVCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

WB (Western Blot)

(Researcher: Dr. Maria de Lourdes Munoz, Department of Genetics and Molecular BiologyApplication: Western blottingSpecies + Tissue/Cell type: Aedes albopictus c6/36 cells, Aedes aegypti midguts, human WBCHow many ug's of tissue/cell lysate run on the gel: 1. 10 ug Aedes albopictus c6/36 cell lysate 2. 10 ug Aedes aegypti midgut lysate 3. 10 ug human white blood cell lysatePrimary antibody dilution: 1:1000Secondary antibody: Goat Anti-Rabbit HRPSecondary antibody dilution: 1:5000)

product-image-AAA199567_WB15.jpg WB (Western Blot) (Researcher: Dr. Maria de Lourdes Munoz, Department of Genetics and Molecular BiologyApplication: Western blottingSpecies + Tissue/Cell type: Aedes albopictus c6/36 cells, Aedes aegypti midguts, human WBCHow many ug's of tissue/cell lysate run on the gel: 1. 10 ug Aedes albopictus c6/36 cell lysate 2. 10 ug Aedes aegypti midgut lysate 3. 10 ug human white blood cell lysatePrimary antibody dilution: 1:1000Secondary antibody: Goat Anti-Rabbit HRPSecondary antibody dilution: 1:5000)
Related Product Information for anti-HAVCR2 antibody
This is a rabbit polyclonal antibody against HAVCR2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. HAVCR2 is the receptor for LGALS9.CD4 (MIM 186940)-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells and their associated cytokines are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. The 2 types of cells also cross-regulate the functions of the other. TIM3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-HAVCR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
hepatitis A virus cellular receptor 2
NCBI Official Synonym Full Names
hepatitis A virus cellular receptor 2
NCBI Official Symbol
HAVCR2
NCBI Official Synonym Symbols
TIM3; CD366; KIM-3; TIMD3; Tim-3; TIMD-3; HAVcr-2
NCBI Protein Information
hepatitis A virus cellular receptor 2
UniProt Protein Name
Hepatitis A virus cellular receptor 2
UniProt Gene Name
HAVCR2
UniProt Synonym Gene Names
TIM3; TIMD3; HAVcr-2; TIMD-3; TIM-3
UniProt Entry Name
HAVR2_HUMAN

Similar Products

Product Notes

The HAVCR2 havcr2 (Catalog #AAA199567) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HAVCR2 antibody - N-terminal region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's HAVCR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HAVCR2 havcr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFSHLPFDCV LLLLLLLLTR SSEVEYRAEV GQNAYLPCFY TPAAPGNLVP. It is sometimes possible for the material contained within the vial of "HAVCR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.