Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282430_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of TF-1 cells using HBG1/HBG2 Rabbit pAb (AAA282430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit anti-Human HBG1/HBG2 Polyclonal Antibody | anti-HBG1/HBG2 antibody

HBG1/HBG2 Rabbit pAb

Gene Names
HBG2; TNCY; HBG-T1
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
HBG1/HBG2, Antibody; HBG1/HBG2 Rabbit pAb; TNCY; HBG-T1; anti-HBG1/HBG2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVD
Applicable Applications for anti-HBG1/HBG2 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
TF-1
Cellular Location
blood microparticle, cytosol, hemoglobin complex
Research Area
Cardiovascular, Blood
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HBG1/HBG2 (NP_000175.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of TF-1 cells using HBG1/HBG2 Rabbit pAb (AAA282430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282430_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of TF-1 cells using HBG1/HBG2 Rabbit pAb (AAA282430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of K-562 cells using HBG1/HBG2 Rabbit pAb (AAA282430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282430_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of K-562 cells using HBG1/HBG2 Rabbit pAb (AAA282430) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of TF-1, using HBG1/HBG2 Rabbit pAb (AAA282430) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.)

product-image-AAA282430_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of TF-1, using HBG1/HBG2 Rabbit pAb (AAA282430) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.)
Related Product Information for anti-HBG1/HBG2 antibody
The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Product Categories/Family for anti-HBG1/HBG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
16,126 Da
NCBI Official Full Name
Hemoglobin subunit gamma-2
NCBI Official Synonym Full Names
hemoglobin, gamma G
NCBI Official Symbol
HBG2
NCBI Official Synonym Symbols
TNCY; HBG-T1
NCBI Protein Information
hemoglobin subunit gamma-2; hb F Ggamma; methemoglobin; gamma-2-globin; abnormal hemoglobin; G-gamma globin Paulinia; hemoglobin gamma-2 chain; hemoglobin gamma-G chain
UniProt Protein Name
Hemoglobin subunit gamma-2
UniProt Gene Name
HBG2
UniProt Entry Name
HBG2_HUMAN

Similar Products

Product Notes

The HBG1/HBG2 hbg2 (Catalog #AAA282430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HBG1/HBG2 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HBG1/HBG2 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the HBG1/HBG2 hbg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGHFTEEDKA TITSLWGKVN VEDAGGETLG RLLVVYPWTQ RFFDSFGNLS SASAIMGNPK VKAHGKKVLT SLGDAIKHLD DLKGTFAQLS ELHCDKLHVD. It is sometimes possible for the material contained within the vial of "HBG1/HBG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.