IF (Immunofluorescence)
(Immunofluorescence analysis of H9C2 cells using HINT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Rabbit HINT1 Polyclonal Antibody | anti-HINT1 antibody
HINT1 Rabbit pAb
Gene Names
HSF1; HSTF1
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
HINT1, Antibody; HINT1 Rabbit pAb; HINT1; HINT; NMAN; PKCI-1; PRKCNH1; histidine triad nucleotide-binding protein 1; anti-HINT1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
Applicable Applications for anti-HINT1 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human HINT1 (NP_005331.1).
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of H9C2 cells using HINT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of H9C2 cells using HINT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
WB (Western Blot)
(Western blot analysis of extracts from normal (control) and HINT1 knockout (KO) HeLa cells, using HINT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
WB (Western Blot)
(Western blot analysis of extracts from normal (control) and HINT1 knockout (KO) HeLa cells, using HINT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-HINT1 antibody
This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed.
Product Categories/Family for anti-HINT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,260 Da
NCBI Official Full Name
heat shock factor protein 1
NCBI Official Synonym Full Names
heat shock transcription factor 1
NCBI Official Symbol
HSF1
NCBI Official Synonym Symbols
HSTF1
NCBI Protein Information
heat shock factor protein 1; HSF 1; HSTF 1
UniProt Protein Name
Heat shock factor protein 1
UniProt Gene Name
HSF1
UniProt Synonym Gene Names
HSTF1; HSF 1; HSTF 1
UniProt Entry Name
HSF1_HUMAN
Similar Products
Product Notes
The HINT1 hsf1 (Catalog #AAA282276) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HINT1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HINT1 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the HINT1 hsf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TSTPEKCLSV ACLDKNELSD HLDAMDSNLD NLQTMLSSHG FSVDTSALLD LFSPSVTVPD MSLPDLDSSL ASIQELLSPQ EPPRPPEAEN SSPDSGKQLV HYTAQPLFLL DPGSVDTGSN DLPVLFELGE GSYFSEGDGF AEDPTISLLT GSEPPKAKDP TVS. It is sometimes possible for the material contained within the vial of "HINT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.