Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199992_WB13.jpg WB (Western Blot) (WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateHLA-F is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit HLA-F Polyclonal Antibody | anti-HLA-F antibody

HLA-F antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HLA-F; HLAF; CDA12; HLA-5.4; HLA-CDA12
Reactivity
Cow, Human, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HLA-F, Antibody; HLA-F antibody - N-terminal region; anti-HLA-F antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
Sequence Length
442
Applicable Applications for anti-HLA-F antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Human: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-F
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateHLA-F is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA199992_WB13.jpg WB (Western Blot) (WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateHLA-F is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

IHC (Immunohistochemistry)

(Rabbit Anti-HLA-F AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Membrane and cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199992_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-HLA-F AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Membrane and cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-HLA-F antibody
This is a rabbit polyclonal antibody against HLA-F. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene exhibits few polymorphisms. Multiple transcript variants encoding different isoforms have been found for this gene. These variants lack a coding exon found in transcripts from other HLA paralogues due to an altered splice acceptor site, resulting in a shorter cytoplasmic domain.
Product Categories/Family for anti-HLA-F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
HLA class I histocompatibility antigen, alpha chain F isoform 1
NCBI Official Synonym Full Names
major histocompatibility complex, class I, F
NCBI Official Symbol
HLA-F
NCBI Official Synonym Symbols
HLAF; CDA12; HLA-5.4; HLA-CDA12
NCBI Protein Information
HLA class I histocompatibility antigen, alpha chain F
UniProt Protein Name
HLA class I histocompatibility antigen, alpha chain F
UniProt Gene Name
HLA-F
UniProt Synonym Gene Names
HLA-5.4; HLAF
UniProt Entry Name
HLAF_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HLA-F hla-f (Catalog #AAA199992) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLA-F antibody - N-terminal region reacts with Cow, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's HLA-F can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HLA-F hla-f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAGSHTLQGM NGCDMGPDGR LLRGYHQHAY DGKDYISLNE DLRSWTAADT. It is sometimes possible for the material contained within the vial of "HLA-F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.