<
IHC (Immunohistochemistry)
(Anti- HMG4 Picoband antibody, AAA46473, IHC(P)IHC(P): Human Placenta Tissue)
HMG4 Polyclonal Antibody | anti-HMG4 antibody
Anti-HMG4 Antibody
Gene Names
HMGB3; HMG4; HMG-4; HMG2A; HMG-2a
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
HMG4, Antibody; Anti-HMG4 Antibody; High mobility group protein B3; chromosomal protein, Nonhistone, HMG4; High mobility group (nonhistone chromosomal) protein 4; High mobility group box 3; High mobility group protein 2a; High mobility group protein 4; High mobility group protein HMG4; HMG 4; HMG-2a; HMG-4; HMG2A; HMGB 3; HMGB3; HMGB3_HUMAN; MGC90319; Non histone chromosomal protein; Nonhistone chromosomal protein HMG4; high mobility group box 3; anti-HMG4 antibody
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
200
Applicable Applications for anti-HMG4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohistochemistry)
(Anti- HMG4 Picoband antibody, AAA46473, IHC(P)IHC(P): Human Placenta Tissue)
IHC (Immunohistochemistry)
(Anti- HMG4 Picoband antibody, AAA46473, IHC(P)IHC(P): Human Placenta Tissue)
IHC (Immunohistochemisry)
(Anti- HMG4 Picoband antibody, AAA46473, IHC(P)IHC(P): Rat Intestine Tissue)
IHC (Immunohistochemisry)
(Anti- HMG4 Picoband antibody, AAA46473, IHC(P)IHC(P): Rat Intestine Tissue)
IHC (Immunohiostchemistry)
(Anti- HMG4 Picoband antibody, AAA46473, IHC(P)IHC(P): Mouse Intestine Tissue)
IHC (Immunohiostchemistry)
(Anti- HMG4 Picoband antibody, AAA46473, IHC(P)IHC(P): Mouse Intestine Tissue)
WB (Western Blot)
(Anti- HMG4 Picoband antibody, AAA46473, Western blottingAll lanes: Anti HMG4 (AAA46473) at 0.5ug/mlLane 1: Mouse Liver Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugLane 3: Mouse Testis Tissue Lysate at 50ugLane 4: 22RV1 Whole Cell Lysate at 40ugLane 5: MCF-7 Whole Cell Lysate at 40ugLane 6: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 23KDObserved bind size: 23KD)
WB (Western Blot)
(Anti- HMG4 Picoband antibody, AAA46473, Western blottingAll lanes: Anti HMG4 (AAA46473) at 0.5ug/mlLane 1: Mouse Liver Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugLane 3: Mouse Testis Tissue Lysate at 50ugLane 4: 22RV1 Whole Cell Lysate at 40ugLane 5: MCF-7 Whole Cell Lysate at 40ugLane 6: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 23KDObserved bind size: 23KD)
Related Product Information for anti-HMG4 antibody
Description: Rabbit IgG polyclonal antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Background: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Background: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
References
1. "Entrez Gene: HMGB3 high-mobility group box 3". 2. Davis DL, Burch JB (1992). "Isolation of a chicken HMG2 cDNA clone and evidence for an HMG2-specific 3'-untranslated region.". Gene 113 (2): 251-6. 3. Vaccari T, Beltrame M, Ferrari S, Bianchi ME (Aug 1998). "Hmg4, a new member of the Hmg1/2 gene family".Genomics 49 (2): 247-52.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,980 Da
NCBI Official Full Name
high mobility group protein B3 isoform a
NCBI Official Synonym Full Names
high mobility group box 3
NCBI Official Symbol
HMGB3
NCBI Official Synonym Symbols
HMG4; HMG-4; HMG2A; HMG-2a
NCBI Protein Information
high mobility group protein B3
UniProt Protein Name
High mobility group protein B3
UniProt Gene Name
HMGB3
UniProt Synonym Gene Names
HMG2A; HMG4; HMG-2a; HMG-4
UniProt Entry Name
HMGB3_HUMAN
Similar Products
Product Notes
The HMG4 hmgb3 (Catalog #AAA46473) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-HMG4 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HMG4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HMG4 hmgb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.