<
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
Rabbit HMGB1 Polyclonal Antibody | anti-HMGB1 antibody
Anti-HMGB1 Antibody
Gene Names
HMGB1; HMG1; HMG3; HMG-1; SBP-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
HMGB1, Antibody; Anti-HMGB1 Antibody; Amphoterin; HMG-1; HMG1; HMG3; HMGB 1; HMGB1; SBP 1; P09429; High mobility group protein B1; high mobility group box 1; anti-HMGB1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
215
Applicable Applications for anti-HMGB1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: Concentration: 0.1-0.5ug/ml ; Tested Species: Human, Mouse, Rat
Immunohistochemistry(IHC) Paraffin: Concentration: 0.5-1ug/ml ; Tested Species: Human, Mouse, Rat ; Antigen Retrieval : By Heat
Immunocytochemistry/ Immunofluorescence (IF/ICC): Concentration: 2ug/mL ; Tested Species: Human
Flow Cytometry (FC): Concentration: 1-3ug/1X106cells ; Tested Species: Human
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunohistochemistry(IHC) Paraffin: Concentration: 0.5-1ug/ml ; Tested Species: Human, Mouse, Rat ; Antigen Retrieval : By Heat
Immunocytochemistry/ Immunofluorescence (IF/ICC): Concentration: 2ug/mL ; Tested Species: Human
Flow Cytometry (FC): Concentration: 1-3ug/1X106cells ; Tested Species: Human
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Recommended Detection Systems
The lab recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (please inquire) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC(P) and ICC.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistchemistry)
(HMGB1 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistchemistry)
(HMGB1 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
IHC (Immunohistochemistry)
(HMGB1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
WB (Western Blot)
(Western blot analysis of HMGB1 expression in rat brain extract (lane 1), mouse ovary extract (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). HMGB1 at 25KD was detected using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
WB (Western Blot)
(Western blot analysis of HMGB1 expression in rat brain extract (lane 1), mouse ovary extract (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). HMGB1 at 25KD was detected using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-HMGB1 antibody
Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection.
Background: High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.
Background: High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.
References
1. Ferrari S, Finelli P, Rocchi M, Bianchi ME (July 1996). "The active gene that encodes human high mobility group 1 protein (HMG1) contains introns and maps to chromosome 13". Genomics. 35 (2): 367-71.
2. Klune JR, Dhupar R, Cardinal J, Billiar TR, Tsung A (2008)."HMGB1: endogenous danger signaling". Mol. Med. 14 (7-8): 476-84.
3. Yang H, Hreggvidsdottir HS, Palmblad K, Wang H, Ochani M, Li J, Lu B, Chavan S, Rosas-Ballina M, Al-Abed Y, Akira S, Bierhaus A, Erlandsson-Harris H, Andersson U, Tracey KJ (June 2010). "A critical cysteine is required for HMGB1 binding to Toll-like receptor 4 and activation of macrophage cytokine release". Proc. Natl. Acad. Sci. U.S.A. 107 (26): 11942-7.
2. Klune JR, Dhupar R, Cardinal J, Billiar TR, Tsung A (2008)."HMGB1: endogenous danger signaling". Mol. Med. 14 (7-8): 476-84.
3. Yang H, Hreggvidsdottir HS, Palmblad K, Wang H, Ochani M, Li J, Lu B, Chavan S, Rosas-Ballina M, Al-Abed Y, Akira S, Bierhaus A, Erlandsson-Harris H, Andersson U, Tracey KJ (June 2010). "A critical cysteine is required for HMGB1 binding to Toll-like receptor 4 and activation of macrophage cytokine release". Proc. Natl. Acad. Sci. U.S.A. 107 (26): 11942-7.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
high mobility group protein B1
NCBI Official Synonym Full Names
high mobility group box 1
NCBI Official Symbol
HMGB1
NCBI Official Synonym Symbols
HMG1; HMG3; HMG-1; SBP-1
NCBI Protein Information
high mobility group protein B1
UniProt Protein Name
High mobility group protein B1
UniProt Gene Name
HMGB1
UniProt Synonym Gene Names
HMG1; HMG-1
Similar Products
Product Notes
The HMGB1 hmgb1 (Catalog #AAA11677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-HMGB1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HMGB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: Concentration: 0.1-0.5ug/ml ; Tested Species: Human, Mouse, Rat Immunohistochemistry(IHC) Paraffin: Concentration: 0.5-1ug/ml ; Tested Species: Human, Mouse, Rat ; Antigen Retrieval : By Heat Immunocytochemistry/ Immunofluorescence (IF/ICC): Concentration: 2ug/mL ; Tested Species: Human Flow Cytometry (FC): Concentration: 1-3ug/1X106cells ; Tested Species: Human Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the HMGB1 hmgb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMGB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.