Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198811_WB13.jpg WB (Western Blot) (WB Suggested Anti-HNRNPA2B1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateHNRNPA2B1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit HNRNPA2B1 Polyclonal Antibody | anti-HNRNPA2B1 antibody

HNRNPA2B1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HNRNPA2B1; RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; IBMPFD2; HNRPA2B1
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HNRNPA2B1, Antibody; HNRNPA2B1 antibody - N-terminal region; anti-HNRNPA2B1 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC
Sequence Length
353
Applicable Applications for anti-HNRNPA2B1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRNPA2B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HNRNPA2B1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateHNRNPA2B1 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198811_WB13.jpg WB (Western Blot) (WB Suggested Anti-HNRNPA2B1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateHNRNPA2B1 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Rabbit Anti-HNRNPA2B1 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198811_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-HNRNPA2B1 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-HNRNPA2B1 antibody
This is a rabbit polyclonal antibody against HNRNPA2B1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRNPA2B1 has two repeats of quasi-RRM domains that bind to RNAs.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoproteins A2/B1 isoform B1
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A2/B1
NCBI Official Symbol
HNRNPA2B1
NCBI Official Synonym Symbols
RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; IBMPFD2; HNRPA2B1
NCBI Protein Information
heterogeneous nuclear ribonucleoproteins A2/B1
UniProt Protein Name
Heterogeneous nuclear ribonucleoproteins A2/B1
UniProt Gene Name
HNRNPA2B1
UniProt Synonym Gene Names
HNRPA2B1; hnRNP A2/B1
UniProt Entry Name
ROA2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HNRNPA2B1 hnrnpa2b1 (Catalog #AAA198811) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRNPA2B1 antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's HNRNPA2B1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HNRNPA2B1 hnrnpa2b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEKTLETVPL ERKKREKEQF RKLFIGGLSF ETTEESLRNY YEQWGKLTDC. It is sometimes possible for the material contained within the vial of "HNRNPA2B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.