Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23482_WB7.jpg WB (Western Blot) (WB Suggested Anti-HNRPA0 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit HNRPA0 Polyclonal Antibody | anti-HNRNPA0 antibody

HNRPA0 antibody - middle region

Gene Names
HNRNPA0; HNRPA0
Reactivity
Cow, Dog, Human, Pig
Applications
Immunofluorescence, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
HNRPA0, Antibody; HNRPA0 antibody - middle region; anti-HNRNPA0 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
Sequence Length
305
Applicable Applications for anti-HNRNPA0 antibody
IF (Immunofluorescence), IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Human: 100%; Pig: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HNRPA0 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

product-image-AAA23482_WB7.jpg WB (Western Blot) (WB Suggested Anti-HNRPA0 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Sample Type: HeLa S3, MCF7, K562Lanes :Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysatePrimary Antibody Dilution :1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :HNRPA0Submitted by :Anonymous)

product-image-AAA23482_WB6.jpg WB (Western Blot) (Sample Type: HeLa S3, MCF7, K562Lanes :Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysatePrimary Antibody Dilution :1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :HNRPA0Submitted by :Anonymous)

IP (Immunoprecipitation)

(Sample Type: K562Amount and Sample Type :Lane 1: 5% InputLane 2: 5% SupLane 3: Normal IgGLane 4: hn-RNPA0 ppt. k562 sampleIP Antibody :HNRPA0Amount of IP Antibody :Primary Antibody :HNRPA0Primary Antibody Dilution:1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name :HNRPA0Submitted by:Anonymous)

product-image-AAA23482_IP5.jpg IP (Immunoprecipitation) (Sample Type: K562Amount and Sample Type :Lane 1: 5% InputLane 2: 5% SupLane 3: Normal IgGLane 4: hn-RNPA0 ppt. k562 sampleIP Antibody :HNRPA0Amount of IP Antibody :Primary Antibody :HNRPA0Primary Antibody Dilution:1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name :HNRPA0Submitted by:Anonymous)

IHC (Immunohistochemistry)

(Rabbit Anti-HNRPA0 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23482_IHC4.jpg IHC (Immunohistochemistry) (Rabbit Anti-HNRPA0 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-HNRPA0 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23482_IHC3.jpg IHC (Immunohistochemistry) (Rabbit Anti-HNRPA0 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-HNRNPA0 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23482_IHC2.jpg IHC (Immunohistochemistry) (Rabbit Anti-HNRNPA0 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IF (Immunofluorescence)

(Sample Type: MCF-7Sample Type :MCF7 cellsPrimary Antibody Dilution :1:200Secondary Antibody:Anti-rabbit-FITCSecondary Antibody Dilution:1:500Color/Signal Descriptions:DAPI: Blue hn-RNPA0: GreenGene Name:HNRPA0Submitted by:Anonymous)

product-image-AAA23482_IF.jpg IF (Immunofluorescence) (Sample Type: MCF-7Sample Type :MCF7 cellsPrimary Antibody Dilution :1:200Secondary Antibody:Anti-rabbit-FITCSecondary Antibody Dilution:1:500Color/Signal Descriptions:DAPI: Blue hn-RNPA0: GreenGene Name:HNRPA0Submitted by:Anonymous)
Related Product Information for anti-HNRNPA0 antibody
This is a rabbit polyclonal antibody against HNRPA0. It was validated on Western Blot and immunohistochemistry

Target Description: HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A0
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A0
NCBI Official Symbol
HNRNPA0
NCBI Official Synonym Symbols
HNRPA0
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A0
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A0
UniProt Gene Name
HNRNPA0
UniProt Synonym Gene Names
HNRPA0; hnRNP A0
UniProt Entry Name
ROA0_HUMAN

Similar Products

Product Notes

The HNRNPA0 hnrnpa0 (Catalog #AAA23482) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRPA0 antibody - middle region reacts with Cow, Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's HNRPA0 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HNRNPA0 hnrnpa0 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAAVVKFHPI QGHRVEVKKA VPKEDIYSGG GGGGSRSSRG GRGGRGRGGG. It is sometimes possible for the material contained within the vial of "HNRPA0, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.