<
WB (Western Blot)
(MCF7 cells staied with HNRPH1 antibody at 1.0ug/ml)
Rabbit HNRPH1 Polyclonal Antibody | anti-HNRPH1 antibody
HNRPH1 antibody
Gene Names
HNRNPH1; HNRPH; HNRPH1; hnRNPH
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
HNRPH1, Antibody; HNRPH1 antibody; Polyclonal HNRPH1; Anti-HNRPH1; HNRPH; HNRPH 1; DKFZp686A15170; Heterogeneous Nuclear Ribonucleoprotein H1; HNRPH-1; hnRNPH; HNRPH1; anti-HNRPH1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
HNRPH1 antibody was raised against the middle region of Hnrph1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPH1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
449
Applicable Applications for anti-HNRPH1 antibody
WB (Western Blot)
Biological Significance
HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
WB (Western Blot)
(MCF7 cells staied with HNRPH1 antibody at 1.0ug/ml)
WB (Western Blot)
(MCF7 cells staied with HNRPH1 antibody at 1.0ug/ml)
WB (Western Blot)
(Lanes : Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysate. HNRPH1 antibody at 1:4000.)
WB (Western Blot)
(Lanes : Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysate. HNRPH1 antibody at 1:4000.)
WB (Western Blot)
(Jurkat cells stained with HNRPH1 antibody at 1.0ug/ml)
WB (Western Blot)
(Jurkat cells stained with HNRPH1 antibody at 1.0ug/ml)
WB (Western Blot)
(Recommended HNRPH1 Antibody Titration: 0.2-1 ug/ml)
WB (Western Blot)
(Recommended HNRPH1 Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-HNRPH1 antibody
Rabbit polyclonal HNRPH1 antibody raised against the middle region of Hnrph1
Product Categories/Family for anti-HNRPH1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
49 kDa (MW of target protein)
NCBI Official Full Name
HNRPH1
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein H1 (H)
NCBI Official Symbol
HNRNPH1
NCBI Official Synonym Symbols
HNRPH; HNRPH1; hnRNPH
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein H
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein H
UniProt Gene Name
HNRNPH1
UniProt Synonym Gene Names
HNRPH; HNRPH1; hnRNP H
UniProt Entry Name
HNRH1_HUMAN
Similar Products
Product Notes
The HNRPH1 hnrnph1 (Catalog #AAA224266) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRPH1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HNRPH1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HNRPH1 hnrnph1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.