Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197173_WB11.jpg WB (Western Blot) (WB Suggested Anti-HOXA5 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Rabbit HOXA5 Polyclonal Antibody | anti-HOXA5 antibody

HOXA5 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
HOXA5; HOX1; HOX1C; HOX1.3
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HOXA5, Antibody; HOXA5 antibody - middle region; anti-HOXA5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
Sequence Length
270
Applicable Applications for anti-HOXA5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HOXA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HOXA5 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

product-image-AAA197173_WB11.jpg WB (Western Blot) (WB Suggested Anti-HOXA5 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

IHC (Immunohiostchemistry)

(Sample Type :Mouse dorsal skin -5d postnatalPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:500Color/Signal Descriptions :Brown: HOXA5Gene Name :HOXA5Submitted by :Alexander Awgulewitsch, Ph.D.Associate Professor - Dept. of MedicineDirector - MUSC Transgenic Mouse Core Medical University of South Carolina (MUSC)96 Jonathan Lucas St. / Suite 912 CSBCharleston, SC 29425)

product-image-AAA197173_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type :Mouse dorsal skin -5d postnatalPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:500Color/Signal Descriptions :Brown: HOXA5Gene Name :HOXA5Submitted by :Alexander Awgulewitsch, Ph.D.Associate Professor - Dept. of MedicineDirector - MUSC Transgenic Mouse Core Medical University of South Carolina (MUSC)96 Jonathan Lucas St. / Suite 912 CSBCharleston, SC 29425)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA197173_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-HOXA5 antibody
This is a rabbit polyclonal antibody against HOXA5. It was validated on Western Blot

Target Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
homeobox protein Hox-A5
NCBI Official Synonym Full Names
homeobox A5
NCBI Official Symbol
HOXA5
NCBI Official Synonym Symbols
HOX1; HOX1C; HOX1.3
NCBI Protein Information
homeobox protein Hox-A5

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HOXA5 (Catalog #AAA197173) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXA5 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HOXA5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HOXA5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGTASGAEED APASSEQASA QSEPSPAPPA QPQIYPWMRK LHISHDNIGG. It is sometimes possible for the material contained within the vial of "HOXA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.