Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199072_WB13.jpg WB (Western Blot) (WB Suggested Anti-HP Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit HP Polyclonal Antibody | anti-HP antibody

HP antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HP; BP; HPA1S; HP2ALPHA2
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HP, Antibody; HP antibody - N-terminal region; anti-HP antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY
Sequence Length
406
Applicable Applications for anti-HP antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 77%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HP Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199072_WB13.jpg WB (Western Blot) (WB Suggested Anti-HP Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(HP (haptoglobin)antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199072_IHC15.jpg IHC (Immunohistochemistry) (HP (haptoglobin)antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-HP antibody
This is a rabbit polyclonal antibody against HP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.
Product Categories/Family for anti-HP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
haptoglobin isoform 1 preproprotein
NCBI Official Synonym Full Names
haptoglobin
NCBI Official Symbol
HP
NCBI Official Synonym Symbols
BP; HPA1S; HP2ALPHA2
NCBI Protein Information
haptoglobin
UniProt Protein Name
Haptoglobin
UniProt Gene Name
HP
UniProt Entry Name
HPT_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HP hp (Catalog #AAA199072) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HP antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HP can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HP hp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSALGAVIAL LLWGQLFAVD SGNDVTDIAD DGCPKPPEIA HGYVEHSVRY. It is sometimes possible for the material contained within the vial of "HP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.