Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28328_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using HSP27/HSP27/HSPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit HSP27/HSPB1 Polyclonal Antibody | anti-HSP27/HSPB1 antibody

[KO Validated] HSP27/HSPB1 Rabbit pAb

Gene Names
HSPB1; CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
HSP27/HSPB1, Antibody; [KO Validated] HSP27/HSPB1 Rabbit pAb; HSPB1; CMT2F; HEL-S-102; HMN2B; HS.76067; HSP27; HSP28; Hsp25; SRP27; anti-HSP27/HSPB1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
Applicable Applications for anti-HSP27/HSPB1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HSP27/HSP27/HSPB1 (NP_001531.1).
Cellular Location
Cytoplasm, Nucleus, cytoskeleton, spindle
Positive Samples
HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using HSP27/HSP27/HSPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28328_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using HSP27/HSP27/HSPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using HSP27/HSP27/HSPB1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28328_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using HSP27/HSP27/HSPB1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using HSP27/HSP27/HSPB1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28328_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using HSP27/HSP27/HSPB1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat ovary using HSP27/HSP27/HSPB1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28328_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat ovary using HSP27/HSP27/HSPB1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using HSP27/HSP27/HSPB1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28328_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using HSP27/HSP27/HSPB1 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of HeLa cells, using HSP27/HSP27/HSPB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA28328_WB2.jpg WB (Western Blot) (Western blot analysis of extracts of HeLa cells, using HSP27/HSP27/HSPB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and HSP27/HSP27/HSPB1 knockout (KO) HeLa cells, using HSP27/HSP27/HSPB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

product-image-AAA28328_WB.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and HSP27/HSP27/HSPB1 knockout (KO) HeLa cells, using HSP27/HSP27/HSPB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-HSP27/HSPB1 antibody
Background: The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,783 Da
NCBI Official Full Name
heat shock protein beta-1
NCBI Official Synonym Full Names
heat shock 27kDa protein 1
NCBI Official Symbol
HSPB1
NCBI Official Synonym Symbols
CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067
NCBI Protein Information
heat shock protein beta-1; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; heat shock 27kD protein 1; stress-responsive protein 27; estrogen-regulated 24 kDa protein
UniProt Protein Name
Heat shock protein beta-1
UniProt Gene Name
HSPB1
UniProt Synonym Gene Names
HSP27; HSP28; HspB1; HSP 27; SRP27
UniProt Entry Name
HSPB1_HUMAN

Similar Products

Product Notes

The HSP27/HSPB1 hspb1 (Catalog #AAA28328) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] HSP27/HSPB1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSP27/HSPB1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the HSP27/HSPB1 hspb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTERRVPFSL LRGPSWDPFR DWYPHSRLFD QAFGLPRLPE EWSQWLGGSS WPGYVRPLPP AAIESPAVAA PAYSRALSRQ LSSGVSEIRH TADRWRVSLD VNHFAPDELT VKTKDGVVEI. It is sometimes possible for the material contained within the vial of "HSP27/HSPB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.