Hsp70 Polyclonal Antibody | anti-Hsp70 antibody

Anti-Hsp70 Antibody

Cat. Num. AAA46564

• Gene Names: HSPA1A; HSP72; HSPA1; HSP70I; HSP70-1; HSP70.1; HSP70-1A; HEL-S-103
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: Hsp70, Antibody; Anti-Hsp70 Antibody; Heat shock 70 kDa protein 1A/1B; DAQB 147D11.1 001; FLJ54303; FLJ54370; FLJ54392; FLJ54408; FLJ75127; Heat shock 70 kDa protein 1; Heat shock 70 kDa protein 1/2; heat shock 70kDa protein 1A; Heat shock 70kDa protein 1B; Heat shock induced protein; heat shock protein 70; HSP70 1; HSP70 2; HSP70-1/HSP70-2; HSP70-1A; HSP70.1; HSP70.1/HSP70.2; HSP70I; HSP71_HUMAN; HSP72; HSPA1; HSPA1A; HSPA1B; XXbac BCX40G17.3 001 antibody; anti-Hsp70 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 641

• Applicable Applications for anti-Hsp70 antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Hsp70 Picoband antibody, AAA46564, IHC(P)IHC(P): Human Lung Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- Hsp70 Picoband antibody, AAA46564, IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- Hsp70 Picoband antibody, AAA46564, IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- Hsp70 Picoband antibody, AAA46564, Western blottingAll lanes: Anti Hsp70 (AAA46564) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 70KDObserved bind size: 70KD)

Related Product Information for anti-Hsp70 antibody

Description: Rabbit IgG polyclonal antibody for Heat shock 70 kDa protein 1A/1B(HSPA1A) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.

References

1. Becker, T., Hartl, F.-U., Wieland, F. CD40, an extracellular receptor for binding and uptake of Hsp70-peptide complexes. J. Cell Biol. 158: 1277-1285, 2002. 2. Gehrig, S. M., van der Poel, C., Sayer, T. A., Schertzer, J. D., Henstridge, D. C., Church, J. E., Lamon, S., Russell, A. P., Davies, K. E., Febbraio, M. A., Lynch, G. S. Hsp72 preserves muscle function and slows progression of severe muscular dystrophy. Nature 484: 394-398, 2012. 3. Shimizu, S., Nomura, K., Ujihara, M., Demura, H. An additional exon of stress-inducible heat shock protein 70 gene (HSP70-1). Biochem. Biophys. Res. Commun. 257: 193-198, 1999.

NCBI and Uniprot Product Information

• NCBI GI #: 194248072
• NCBI GeneID: 3303
• NCBI Accession #: NP_005336.3
• NCBI GenBank Nucleotide #: NM_005345.5
• UniProt Accession #: P0DMV8; P08107; P19790; Q5JQI4; Q5SP17; Q9UQL9; Q9UQM0; B4E3B6
• Molecular Weight: 63,937 Da
• NCBI Official Full Name: heat shock 70 kDa protein 1A
• NCBI Official Synonym Full Names: heat shock protein family A (Hsp70) member 1A
• NCBI Official Symbol: HSPA1A
• NCBI Official Synonym Symbols: HSP72; HSPA1; HSP70I; HSP70-1; HSP70.1; HSP70-1A; HEL-S-103
• NCBI Protein Information: heat shock 70 kDa protein 1A
• UniProt Protein Name: Heat shock 70 kDa protein 1A
• UniProt Gene Name: HSPA1A
• UniProt Synonym Gene Names: HSPA1; HSX70; HSP70.1
• UniProt Entry Name: HS71A_HUMAN