Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28405_IF9.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit HSP70 Polyclonal Antibody | anti-HSP70 antibody

HSP70 Rabbit pAb

Gene Names
CDK2; p33(CDK2)
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
HSP70, Antibody; HSP70 Rabbit pAb; HEL-S-103; HSP70-1; HSP70-1A; HSP70.1; HSP70I; HSP72; HSPA1; anti-HSP70 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
RALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Applicable Applications for anti-HSP70 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF/ICC: 1:50-1:200
Positive Samples
293T, HeLa, A-549, NIH/3T3, C6, Mouse brain, Mouse lung, Rat heart, Rat liver
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human HSP70 (NP_005336.3).
Cellular Location
blood microparticle, centriole, centrosome, cytoplasm, cytosol, endoplasmic reticulum, extracellular exosome, extracellular region, focal adhesion, mitochondrion, nuclear speck, nucleoplasm, nucleus, perinuclear region of cytoplasm, plasma membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28405_IF9.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28405_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28405_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28405_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-549 cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28405_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A-549 cells using HSP70 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human esophageal cancer using HSP70 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28405_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human esophageal cancer using HSP70 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using HSP70 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28405_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using HSP70 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using HSP70 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA28405_WB2.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using HSP70 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using HSP70 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 0.5s.)

product-image-AAA28405_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using HSP70 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 0.5s.)
Related Product Information for anti-HSP70 antibody
This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which encode similar proteins. [provided by RefSeq, Jul 2008]
Product Categories/Family for anti-HSP70 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,930 Da
NCBI Official Full Name
cyclin-dependent kinase 2 isoform 1
NCBI Official Synonym Full Names
cyclin-dependent kinase 2
NCBI Official Symbol
CDK2
NCBI Official Synonym Symbols
p33(CDK2)
NCBI Protein Information
cyclin-dependent kinase 2; p33 protein kinase; cell devision kinase 2; cdc2-related protein kinase; cell division protein kinase 2
UniProt Protein Name
Cyclin-dependent kinase 2
UniProt Gene Name
CDK2
UniProt Synonym Gene Names
CDKN2
UniProt Entry Name
CDK2_HUMAN

Similar Products

Product Notes

The HSP70 cdk2 (Catalog #AAA28405) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSP70 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSP70 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry). WB: 1:500-1:2000 IHC: 1:50-1:200 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the HSP70 cdk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RALFPGDSEI DQLFRIFRTL GTPDEVVWPG VTSMPDYKPS FPKWARQDFS KVVPPLDEDG RSLLSQMLHY DPNKRISAKA ALAHPFFQDV TKPVPHLRL. It is sometimes possible for the material contained within the vial of "HSP70, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.