Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28434_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using HSP90AB1 antibody. Blue: DAPI for nuclear staining.)

Rabbit Hsp90beta Polyclonal Antibody | anti-Hsp90beta antibody

Hsp90beta Rabbit pAb

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
Hsp90beta, Antibody; Hsp90beta Rabbit pAb; HSP90AB1; D6S182; HSP84; HSP90B; HSPC2; HSPCB; heat shock protein HSP 90-beta; anti-Hsp90beta antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
WNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNGQDQQLYIGWKSRSGSDLDAGRVLRLFGVNISPESSRNDVVGNKRVNDTEMLSLVCSKKQRIFHAS
Applicable Applications for anti-Hsp90beta antibody
WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry)
Application Notes
WB: 1:500-1:2000
IF/ICC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human Hsp90beta (NP_031381.2).
Cellular Location
Cytoplasm, Melanosome
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using HSP90AB1 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA28434_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using HSP90AB1 antibody. Blue: DAPI for nuclear staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28434_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded rat kidney using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human esophagus using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28434_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human esophagus using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human esophageal cancer using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28434_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human esophageal cancer using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28434_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28434_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using Hsp90beta Rabbit pAb at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using HSP90AB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA28434_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using HSP90AB1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-Hsp90beta antibody
This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. This gene encodes the constitutive form of the cytosolic 90 kDa heat-shock protein and is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 83kDa

Similar Products

Product Notes

The Hsp90beta (Catalog #AAA28434) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hsp90beta Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hsp90beta can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry). WB: 1:500-1:2000 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the Hsp90beta for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WNSSQSYVLT KGWSRFVKEK NLRAGDVVSF SRSNGQDQQL YIGWKSRSGS DLDAGRVLRL FGVNISPESS RNDVVGNKRV NDTEMLSLVC SKKQRIFHAS. It is sometimes possible for the material contained within the vial of "Hsp90beta, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.