Rabbit anti-Human HSPA5 Polyclonal Antibody | anti-HSPA5 antibody
HSPA5 Antibody - middle region
Gene Names
HSPA5; BIP; MIF2; GRP78; HEL-S-89n
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HSPA5, Antibody; HSPA5 Antibody - middle region; anti-HSPA5 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIES
Sequence Length
654
Applicable Applications for anti-HSPA5 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HSPA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-HSPA5 antibody
The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. It is localized in the lumen of the endoplasmic reticulum (ER), and is involved in the folding and assembly of proteins in the ER. As this protein interacts with many ER proteins, it may play a key role in monitoring protein transport through the cell.
Product Categories/Family for anti-HSPA5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71 kDa
NCBI Official Full Name
endoplasmic reticulum chaperone BiP
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 5
NCBI Official Symbol
HSPA5
NCBI Official Synonym Symbols
BIP; MIF2; GRP78; HEL-S-89n
NCBI Protein Information
endoplasmic reticulum chaperone BiP
UniProt Protein Name
78 kDa glucose-regulated protein
UniProt Gene Name
HSPA5
UniProt Synonym Gene Names
GRP78; GRP-78; BiP
UniProt Entry Name
GRP78_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HSPA5 hspa5 (Catalog #AAA201600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPA5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HSPA5 hspa5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VMEHFIKLYK KKTGKDVRKD NRAVQKLRRE VEKAKRALSS QHQARIEIES. It is sometimes possible for the material contained within the vial of "HSPA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
