Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23533_WB9.jpg WB (Western Blot) (WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Rabbit HSPA8 Polyclonal Antibody | anti-HSPA8 antibody

HSPA8 antibody - N-terminal region

Gene Names
HSPA8; LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; LAP-1; NIP71; HEL-33; HSPA10; HEL-S-72p
Reactivity
Cow, Goat, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HSPA8, Antibody; HSPA8 antibody - N-terminal region; anti-HSPA8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
Sequence Length
646
Applicable Applications for anti-HSPA8 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

product-image-AAA23533_WB9.jpg WB (Western Blot) (WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

WB (Western Blot)

(HSPA8 antibody - N-terminal region validated by WB using Rat Brain lysate at 1:1,000.)

product-image-AAA23533_WB8.jpg WB (Western Blot) (HSPA8 antibody - N-terminal region validated by WB using Rat Brain lysate at 1:1,000.)

WB (Western Blot)

(Host: RabbitTarget Name: RHOT1Sample Type: JurkatAntibody Dilution: 1.0ug/mlHSPA8 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA23533_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: RHOT1Sample Type: JurkatAntibody Dilution: 1.0ug/mlHSPA8 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlHSPA8 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA23533_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlHSPA8 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: HSPA8Sample Type: Human 293T cellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%)

product-image-AAA23533_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: HSPA8Sample Type: Human 293T cellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%)

WB (Western Blot)

(Host: RabbitTarget Name: HSPA8Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23533_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: HSPA8Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HSPA8Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23533_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: HSPA8Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA23533_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Mouse brainSample Type: Mouse Brain SlicesRed: primaryBlue: DAPIPrimaryDilution: 1:400Secondary Antibody: Anti-Rabbit IgG Alexa 594SecondaryDilution: 1:400Image Submitted By: Adahir Labrador-Garrido and Cintia Roodveldt University of Seville)

product-image-AAA23533_IHC.jpg IHC (Immunohistochemistry) (Sample Type: Mouse brainSample Type: Mouse Brain SlicesRed: primaryBlue: DAPIPrimaryDilution: 1:400Secondary Antibody: Anti-Rabbit IgG Alexa 594SecondaryDilution: 1:400Image Submitted By: Adahir Labrador-Garrido and Cintia Roodveldt University of Seville)
Related Product Information for anti-HSPA8 antibody
This is a rabbit polyclonal antibody against HSPA8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.The product encoded by this gene belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. This gene encodes a heat-shock cognate protein. This protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
heat shock cognate 71 kDa protein isoform 1
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 8
NCBI Official Symbol
HSPA8
NCBI Official Synonym Symbols
LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; LAP-1; NIP71; HEL-33; HSPA10; HEL-S-72p
NCBI Protein Information
heat shock cognate 71 kDa protein
UniProt Protein Name
Heat shock cognate 71 kDa protein
UniProt Gene Name
HSPA8
UniProt Synonym Gene Names
HSC70; HSP73; HSPA10
UniProt Entry Name
HSP7C_HUMAN

Similar Products

Product Notes

The HSPA8 hspa8 (Catalog #AAA23533) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPA8 antibody - N-terminal region reacts with Cow, Goat, Human, Mouse, Pig, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA8 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HSPA8 hspa8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSKGPAVGID LGTTYSCVGV FQHGKVEIIA NDQGNRTTPS YVAFTDTERL. It is sometimes possible for the material contained within the vial of "HSPA8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.