Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200116_WB8.jpg WB (Western Blot) (HYAL1 antibody - N-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.HYAL1 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit HYAL1 Polyclonal Antibody | anti-HYAL1 antibody

HYAL1 antibody - N-terminal region

Gene Names
HYAL1; MPS9; NAT6; LUCA1; HYAL-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HYAL1, Antibody; HYAL1 antibody - N-terminal region; anti-HYAL1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY
Sequence Length
405
Applicable Applications for anti-HYAL1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 83%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HYAL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(HYAL1 antibody - N-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.HYAL1 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA200116_WB8.jpg WB (Western Blot) (HYAL1 antibody - N-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.HYAL1 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: HYAL1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200116_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: HYAL1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HYAL1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200116_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: HYAL1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-HYAL1 antibody)

product-image-AAA200116_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-HYAL1 antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry with breast cancer tissue tissue)

product-image-AAA200116_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with breast cancer tissue tissue)
Related Product Information for anti-HYAL1 antibody
This is a rabbit polyclonal antibody against HYAL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HYAL1 is a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in HYAL1 are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. HYAL1 is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for HYAL1.This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
hyaluronidase-1 isoform 2
NCBI Official Synonym Full Names
hyaluronidase 1
NCBI Official Symbol
HYAL1
NCBI Official Synonym Symbols
MPS9; NAT6; LUCA1; HYAL-1
NCBI Protein Information
hyaluronidase-1
UniProt Protein Name
Hyaluronidase-1
UniProt Gene Name
HYAL1
UniProt Synonym Gene Names
LUCA1; Hyal-1; LuCa-1
UniProt Entry Name
HYAL1_HUMAN

Similar Products

Product Notes

The HYAL1 hyal1 (Catalog #AAA200116) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HYAL1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HYAL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HYAL1 hyal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WNANTQWCLE RHGVDVDVSV FDVVANPGQT FRGPDMTIFY SSQLGTYPYY. It is sometimes possible for the material contained within the vial of "HYAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.