Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA124958_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of HAS1 using anti- HAS1 antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human SHG-44 whole cell lysates,Lane 2: human THP-1 whole cell lysates,Lane 3: rat brain tissue lysates,Lane 4: rat smooth muscle tissue lysates,Lane 5: rat ovary tissue lysates,Lane 6: mouse brain tissue lysates,Lane 7: mouse smooth muscle tissue lysates,Lane 8: mouse ovary tissue lysates,Lane 9: mouse small intestine tissue lysates,Lane 10: mouse Neuro-2a whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- HAS1 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HAS1 at approximately 70KD. The expected band size for HAS1 is at 65KD.)

Rabbit Hyaluronan synthase 1/HAS1 Polyclonal Antibody | anti-HAS1 antibody

Anti-Hyaluronan synthase 1/HAS1 Antibody

Gene Names
HAS1; HAS
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Hyaluronan synthase 1/HAS1, Antibody; Anti-Hyaluronan synthase 1/HAS1 Antibody; Hyaluronan synthase 1; Hyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1; HuHAS1; HAS1; HAS; anti-HAS1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
578
Applicable Applications for anti-HAS1 antibody
ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence of human Hyaluronan synthase 1/HAS1 (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
Content
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

WB (Western Blot)

(Figure 1. Western blot analysis of HAS1 using anti- HAS1 antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human SHG-44 whole cell lysates,Lane 2: human THP-1 whole cell lysates,Lane 3: rat brain tissue lysates,Lane 4: rat smooth muscle tissue lysates,Lane 5: rat ovary tissue lysates,Lane 6: mouse brain tissue lysates,Lane 7: mouse smooth muscle tissue lysates,Lane 8: mouse ovary tissue lysates,Lane 9: mouse small intestine tissue lysates,Lane 10: mouse Neuro-2a whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- HAS1 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HAS1 at approximately 70KD. The expected band size for HAS1 is at 65KD.)

product-image-AAA124958_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of HAS1 using anti- HAS1 antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human SHG-44 whole cell lysates,Lane 2: human THP-1 whole cell lysates,Lane 3: rat brain tissue lysates,Lane 4: rat smooth muscle tissue lysates,Lane 5: rat ovary tissue lysates,Lane 6: mouse brain tissue lysates,Lane 7: mouse smooth muscle tissue lysates,Lane 8: mouse ovary tissue lysates,Lane 9: mouse small intestine tissue lysates,Lane 10: mouse Neuro-2a whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- HAS1 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HAS1 at approximately 70KD. The expected band size for HAS1 is at 65KD.)
Related Product Information for anti-HAS1 antibody
Description: Rabbit IgG polyclonal antibody for Hyaluronan synthase 1/HAS1 detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Background: Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.
References
1. Spicer AP, Seldin MF, Olsen AS, Brown N, Wells DE, Doggett NA, Itano N, Kimata K, Inazawa J, McDonald JA (Jul 1997). "Chromosomal localization of the human and mouse hyaluronan synthase genes". Genomics. 41 (3): 493-7. 2. "Entrez Gene: HAS1 hyaluronan synthase 1".

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,832 Da
NCBI Official Full Name
hyaluronan synthase 1 isoform 1
NCBI Official Synonym Full Names
hyaluronan synthase 1
NCBI Official Symbol
HAS1
NCBI Official Synonym Symbols
HAS
NCBI Protein Information
hyaluronan synthase 1
UniProt Protein Name
Hyaluronan synthase 1
UniProt Gene Name
HAS1
UniProt Synonym Gene Names
HAS; HA synthase 1; HuHAS1

Similar Products

Product Notes

The HAS1 has1 (Catalog #AAA124958) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hyaluronan synthase 1/HAS1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hyaluronan synthase 1/HAS1 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HAS1 has1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hyaluronan synthase 1/HAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.