Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282431_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Recombinant Human IFNL3 Protein, using IFNL2/IFNL3 antibody (AAA282431) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

Rabbit anti-Human, Mouse IFNL2/IFNL3 Polyclonal Antibody | anti-IFNL2/IFNL3 antibody

IFNL2/IFNL3 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
IFNL3; IL28B; IL28C; IL-28B
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
IFNL2/IFNL3, Antibody; IFNL2/IFNL3 Rabbit pAb; IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4; anti-IFNL2/IFNL3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELAL
Applicable Applications for anti-IFNL2/IFNL3 antibody
WB (Western Blot)
Positive Samples
Recombinant Human IFNL3 Protein, K-562, Mouse thymus
Cellular Location
Secreted
Research Area
Growth factors, Immunology Inflammation, Cytokines, Interleukins, Cell Intrinsic Innate Immunity Signaling Pathway
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IFNL2/IFNL3 (NP_742151.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of extracts of Recombinant Human IFNL3 Protein, using IFNL2/IFNL3 antibody (AAA282431) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

product-image-AAA282431_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of Recombinant Human IFNL3 Protein, using IFNL2/IFNL3 antibody (AAA282431) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using IFNL2/IFNL3 antibody (AAA282431) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

product-image-AAA282431_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using IFNL2/IFNL3 antibody (AAA282431) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)
Related Product Information for anti-IFNL2/IFNL3 antibody
This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Product Categories/Family for anti-IFNL2/IFNL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,706 Da
NCBI Official Full Name
interferon lambda-3
NCBI Official Synonym Full Names
interferon, lambda 3
NCBI Official Symbol
IFNL3
NCBI Official Synonym Symbols
IL28B; IL28C; IL-28B
NCBI Protein Information
interferon lambda-3; IL-28C; IFN-lambda-3; IFN-lambda-4; interleukin 28C; interleukin-28B; interleukin-28C; cytokine Zcyto22; interferon lambda-4; interferon, lambda 4; interleukin 28B (interferon, lambda 3)
UniProt Protein Name
Interferon lambda-3
UniProt Gene Name
IFNL3
UniProt Synonym Gene Names
IL28B; IL28C; ZCYTO22; IFN-lambda-3; IL-28B; IL-28C
UniProt Entry Name
IFNL3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IFNL2/IFNL3 ifnl3 (Catalog #AAA282431) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNL2/IFNL3 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IFNL2/IFNL3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IFNL2/IFNL3 ifnl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTGDCMPVLV LMAAVLTVTG AVPVARLRGA LPDARGCHIA QFKSLSPQEL QAFKRAKDAL EESLLLKDCK CRSRLFPRTW DLRQLQVRER PVALEAELAL. It is sometimes possible for the material contained within the vial of "IFNL2/IFNL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.