Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23578_WB7.jpg WB (Western Blot) (WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit IGF2BP1 Polyclonal Antibody | anti-IGF2BP1 antibody

IGF2BP1 antibody - N-terminal region

Gene Names
IGF2BP1; IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
IGF2BP1, Antibody; IGF2BP1 antibody - N-terminal region; anti-IGF2BP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP
Sequence Length
577
Applicable Applications for anti-IGF2BP1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

product-image-AAA23578_WB7.jpg WB (Western Blot) (WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: IGF2BP1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA23578_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: IGF2BP1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: IGF2BP1Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23578_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: IGF2BP1Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: IGF2BP1Sample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)

product-image-AAA23578_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: IGF2BP1Sample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: IGF2BP1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA23578_WB3.jpg WB (Western Blot) (Host: MouseTarget Name: IGF2BP1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type :Human lung carcinomaPrimary Antibody Dilution :1:300Secondary Antibody :Anti-rabbit-linker, Fbex-HRPSecondary Antibody Dilution :NOT FOUNDColor/Signal Descriptions :Brown: IGFBP1 Blue: NucleiGene Name :IGF2BP1Submitted by :Haodong Xu. Department of Pathology, University of Rochester medical Center)

product-image-AAA23578_IHC2.jpg IHC (Immunohistochemistry) (Sample Type :Human lung carcinomaPrimary Antibody Dilution :1:300Secondary Antibody :Anti-rabbit-linker, Fbex-HRPSecondary Antibody Dilution :NOT FOUNDColor/Signal Descriptions :Brown: IGFBP1 Blue: NucleiGene Name :IGF2BP1Submitted by :Haodong Xu. Department of Pathology, University of Rochester medical Center)

IHC (Immunohistochemistry)

(Researcher:Haodong Xu. Department of Pathology, University of Rochester medical CenterApplication: IHCSpecies+tissue/cell type: Human small intestinePrimary antibody dilution: 1:300Secondary antibody: Anti-rabbit-linker, Fbex-HRP)

product-image-AAA23578_IHC.jpg IHC (Immunohistochemistry) (Researcher:Haodong Xu. Department of Pathology, University of Rochester medical CenterApplication: IHCSpecies+tissue/cell type: Human small intestinePrimary antibody dilution: 1:300Secondary antibody: Anti-rabbit-linker, Fbex-HRP)
Related Product Information for anti-IGF2BP1 antibody
This is a rabbit polyclonal antibody against IGF2BP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-IGF2BP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
Insulin-like growth factor 2 mRNA-binding protein 1
NCBI Official Synonym Full Names
insulin like growth factor 2 mRNA binding protein 1
NCBI Official Symbol
IGF2BP1
NCBI Official Synonym Symbols
IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1
NCBI Protein Information
insulin-like growth factor 2 mRNA-binding protein 1
UniProt Protein Name
Insulin-like growth factor 2 mRNA-binding protein 1
UniProt Gene Name
IGF2BP1
UniProt Synonym Gene Names
CRDBP; VICKZ1; ZBP1; IGF2 mRNA-binding protein 1; IMP-1; IMP1; CRD-BP; ZBP-1
UniProt Entry Name
IF2B1_HUMAN

Similar Products

Product Notes

The IGF2BP1 igf2bp1 (Catalog #AAA23578) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGF2BP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's IGF2BP1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the IGF2BP1 igf2bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFVDCPDEHW AMKAIETFSG KVELQGKRLE IEHSVPKKQR SRKIQIRNIP P. It is sometimes possible for the material contained within the vial of "IGF2BP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.