Rabbit Igf2bp1 Polyclonal Antibody | anti-IGF2BP1 antibody
Igf2bp1 antibody - N-terminal region
Gene Names
Igf2bp1; IMP1; Zbp1; Crdbp; IMP-1; ZBP-1; CRD-BP; Neilsen; AL024068; AW549074; D11Moh45; mir-3063; D11Moh40e; D030026A21Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Igf2bp1, Antibody; Igf2bp1 antibody - N-terminal region; anti-IGF2BP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL
Sequence Length
577
Applicable Applications for anti-IGF2BP1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-IGF2BP1 antibody
This is a rabbit polyclonal antibody against Igf2bp1. It was validated on Western Blot
Target Description: Igf2bp1 is a RNA-binding factor that affects mRNA nuclear export, localization, stability and translation.
Target Description: Igf2bp1 is a RNA-binding factor that affects mRNA nuclear export, localization, stability and translation.
Product Categories/Family for anti-IGF2BP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
insulin-like growth factor 2 mRNA-binding protein 1
NCBI Official Synonym Full Names
insulin-like growth factor 2 mRNA binding protein 1
NCBI Official Symbol
Igf2bp1
NCBI Official Synonym Symbols
IMP1; Zbp1; Crdbp; IMP-1; ZBP-1; CRD-BP; Neilsen; AL024068; AW549074; D11Moh45; mir-3063; D11Moh40e; D030026A21Rik
NCBI Protein Information
insulin-like growth factor 2 mRNA-binding protein 1
UniProt Protein Name
Insulin-like growth factor 2 mRNA-binding protein 1
UniProt Gene Name
Igf2bp1
UniProt Synonym Gene Names
Vickz1; IGF2 mRNA-binding protein 1; IMP-1; CRD-BP; ZBP-1
UniProt Entry Name
IF2B1_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The IGF2BP1 igf2bp1 (Catalog #AAA200808) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Igf2bp1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Igf2bp1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IGF2BP1 igf2bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PQLRWEVLDS LLAQYGTVEN CEQVNTESET AVVNVTYSNR EQTRQAIMKL. It is sometimes possible for the material contained within the vial of "Igf2bp1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
