Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199593_WB10.jpg WB (Western Blot) (WB Suggested Anti-IGFBP4 Antibody Titration: 1 ug/mlPositive Control: Fetal Brain Lysate)

Rabbit IGFBP4 Polyclonal Antibody | anti-IGFBP4 antibody

IGFBP4 antibody - middle region

Gene Names
IGFBP4; BP-4; IBP4; IGFBP-4; HT29-IGFBP
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
IGFBP4, Antibody; IGFBP4 antibody - middle region; anti-IGFBP4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
Sequence Length
258
Applicable Applications for anti-IGFBP4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IGFBP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IGFBP4 Antibody Titration: 1 ug/mlPositive Control: Fetal Brain Lysate)

product-image-AAA199593_WB10.jpg WB (Western Blot) (WB Suggested Anti-IGFBP4 Antibody Titration: 1 ug/mlPositive Control: Fetal Brain Lysate)

WB (Western Blot)

(Host: RabbitTarget Name: IGFBP4Sample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199593_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: IGFBP4Sample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: IGFBP4Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA199593_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: IGFBP4Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-IGFBP4 antibody)

product-image-AAA199593_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-IGFBP4 antibody)
Related Product Information for anti-IGFBP4 antibody
This is a rabbit polyclonal antibody against IGFBP4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
insulin-like growth factor-binding protein 4
NCBI Official Synonym Full Names
insulin like growth factor binding protein 4
NCBI Official Symbol
IGFBP4
NCBI Official Synonym Symbols
BP-4; IBP4; IGFBP-4; HT29-IGFBP
NCBI Protein Information
insulin-like growth factor-binding protein 4
UniProt Protein Name
Insulin-like growth factor-binding protein 4
UniProt Gene Name
IGFBP4
UniProt Synonym Gene Names
IBP4; IBP-4; IGF-binding protein 4; IGFBP-4
UniProt Entry Name
IBP4_HUMAN

Similar Products

Product Notes

The IGFBP4 igfbp4 (Catalog #AAA199593) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGFBP4 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IGFBP4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the IGFBP4 igfbp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RALERLAASQ SRTHEDLYII PIPNCDRNGN FHPKQCHPAL DGQRGKCWCV. It is sometimes possible for the material contained within the vial of "IGFBP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.