Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282311_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human tonsil using human IgG (Fc) antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Mouse anti-Human IgG (Fc) Polyclonal Antibody | anti-IgG antibody

human IgG (Fc) Mouse mAb

Average rating 0.0
No ratings yet
Gene Names
PDGFA; PDGF1; PDGF-A
Reactivity
Human
Applications
Immunohistochemistry
Purity
Affinity purification
Synonyms
IgG (Fc), Antibody; human IgG (Fc) Mouse mAb; COB1; YAP; YAP2; YAP65; YKI; YAP1; anti-IgG antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
EEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHATKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQV
Applicable Applications for anti-IgG antibody
IHC (Immunohistochemistry)
Immunogen
A synthesized peptide derived from human human IgG (Fc).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Human tonsil using human IgG (Fc) antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282311_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human tonsil using human IgG (Fc) antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using human IgG (Fc) antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282311_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using human IgG (Fc) antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Related Product Information for anti-IgG antibody
As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as the antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (50 kDa) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcgammaR) on phagocytic cells with high affinity.
Product Categories/Family for anti-IgG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,043 Da
NCBI Official Full Name
platelet-derived growth factor subunit A isoform 1 preproprotein
NCBI Official Synonym Full Names
platelet-derived growth factor alpha polypeptide
NCBI Official Symbol
PDGFA
NCBI Official Synonym Symbols
PDGF1; PDGF-A
NCBI Protein Information
platelet-derived growth factor subunit A; PDGF-1; PDGF A-chain; PDGF subunit A; platelet-derived growth factor A chain; platelet-derived growth factor alpha chain; platelet-derived growth factor alpha isoform 2 preproprotein
UniProt Protein Name
Platelet-derived growth factor subunit A
UniProt Gene Name
PDGFA
UniProt Synonym Gene Names
PDGF1; PDGF subunit A
UniProt Entry Name
PDGFA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IgG pdgfa (Catalog #AAA282311) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The human IgG (Fc) Mouse mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IgG (Fc) can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the IgG pdgfa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEAEIPREVI ERLARSQIHS IRDLQRLLEI DSVGSEDSLD TSLRAHGVHA TKHVPEKRPL PIRRKRSIEE AVPAVCKTRT VIYEIPRSQV. It is sometimes possible for the material contained within the vial of "IgG (Fc), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.