Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283288_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using I?B-? Rabbit pAb (AAA283288) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit anti-Human IkappaB-zeta Polyclonal Antibody | anti-NFKBIZ antibody

IkappaB-zeta Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Affinity purification
Synonyms
IkappaB-zeta, Antibody; IkappaB-zeta Rabbit pAb; IKBZ; INAP; MAIL; ikB-zeta; ikappaBzeta; IkappaB-zeta; I-kappa-B-zeta; NFKBIZ; anti-NFKBIZ antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAPGSPGSDSSDFSSASSVSSCGAVESRSRGGARAERQPVEPH
Applicable Applications for anti-NFKBIZ antibody
ELISA, IHC (Immunohistochemistry)
Cross Reactivity
Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IkappaB-zeta(NP_113607.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using I?B-? Rabbit pAb (AAA283288) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283288_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using I?B-? Rabbit pAb (AAA283288) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using I?B-? Rabbit pAb (AAA283288) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283288_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using I?B-? Rabbit pAb (AAA283288) at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
Related Product Information for anti-NFKBIZ antibody
This gene is a member of the ankyrin-repeat family and is induced by lipopolysaccharide (LPS). The C-terminal portion of the encoded product which contains the ankyrin repeats, shares high sequence similarity with the I kappa B family of proteins. The latter are known to play a role in inflammatory responses to LPS by their interaction with NF-B proteins through ankyrin-repeat domains. Studies in mouse indicate that this gene product is one of the nuclear I kappa B proteins and an activator of IL-6 production. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 78kDa
UniProt Protein Name
NF-kappa-B inhibitor zeta
UniProt Gene Name
NFKBIZ
UniProt Synonym Gene Names
IKBZ; INAP; MAIL; IkB-zeta; IkappaBzeta; INAP; MAIL
UniProt Entry Name
IKBZ_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NFKBIZ nfkbiz (Catalog #AAA283288) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IkappaB-zeta Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IkappaB-zeta can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NFKBIZ nfkbiz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MIVDKLLDDS RGGEGLRDAA GGCGLMTSPL NLSYFYGASP PAAAPGACDA SCSVLGPSAP GSPGSDSSDF SSASSVSSCG AVESRSRGGA RAERQPVEPH. It is sometimes possible for the material contained within the vial of "IkappaB-zeta, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.