Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201519_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: IKZF1Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human IKZF1 Polyclonal Antibody | anti-IKZF1 antibody

IKZF1 Antibody - middle region

Gene Names
IKZF1; IK1; LYF1; LyF-1; CVID13; IKAROS; PPP1R92; PRO0758; ZNFN1A1; Hs.54452
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IKZF1, Antibody; IKZF1 Antibody - middle region; anti-IKZF1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: ASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHK
Sequence Length
388
Applicable Applications for anti-IKZF1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IKZF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: IKZF1Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201519_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: IKZF1Sample Tissue: Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: IKZF1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA201519_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: IKZF1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Related Product Information for anti-IKZF1 antibody
This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors. Overexpression of some dominant-negative isoforms have been associated with B-cell malignancies, such as acute lymphoblastic leukemia (ALL).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
DNA-binding protein Ikaros isoform 2
NCBI Official Synonym Full Names
IKAROS family zinc finger 1
NCBI Official Symbol
IKZF1
NCBI Official Synonym Symbols
IK1; LYF1; LyF-1; CVID13; IKAROS; PPP1R92; PRO0758; ZNFN1A1; Hs.54452
NCBI Protein Information
DNA-binding protein Ikaros
UniProt Protein Name
DNA-binding protein Ikaros
UniProt Gene Name
IKZF1
UniProt Synonym Gene Names
IK1; IKAROS; LYF1; ZNFN1A1
UniProt Entry Name
IKZF1_HUMAN

Similar Products

Product Notes

The IKZF1 ikzf1 (Catalog #AAA201519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IKZF1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IKZF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IKZF1 ikzf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASGEKMNGSH RDQGSSALSG VGGIRLPNGK LKCDICGIIC IGPNVLMVHK. It is sometimes possible for the material contained within the vial of "IKZF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.