Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199521_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: IL12RB2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlIL12RB2 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit IL12RB2 Polyclonal Antibody | anti-IL12RB2 antibody

IL12RB2 Antibody - middle region

Reactivity
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep (Tested Reactivity: Human)
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL12RB2, Antibody; IL12RB2 Antibody - middle region; anti-IL12RB2 antibody
Ordering
Host
Rabbit
Reactivity
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep (Tested Reactivity: Human)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: DVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQ
Sequence Length
659
Applicable Applications for anti-IL12RB2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human IL12RB2
Protein Size
659 amino acids
Protein Interactions
SOCS3; IL12RB2; IL12RB1; STAT4; IL12B; JAK2;
Replacement Item
This antibody may replace item sc-18648 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: IL12RB2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlIL12RB2 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA199521_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: IL12RB2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlIL12RB2 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-IL12RB2 antibody
This is a rabbit polyclonal antibody against IL12RB2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohn's disease and leprosy, which is thought to contribute to the inflammatory response and host defense.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
interleukin-12 receptor subunit beta-2 isoform a
NCBI Official Synonym Full Names
interleukin 12 receptor subunit beta 2
NCBI Official Symbol
IL12RB2
NCBI Protein Information
interleukin-12 receptor subunit beta-2
UniProt Protein Name
Interleukin-12 receptor subunit beta-2
UniProt Gene Name
IL12RB2
UniProt Synonym Gene Names
IL-12 receptor subunit beta-2; IL-12R subunit beta-2; IL-12R-beta-2; IL-12RB2
UniProt Entry Name
I12R2_HUMAN

Similar Products

Product Notes

The IL12RB2 il12rb2 (Catalog #AAA199521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL12RB2 Antibody - middle region reacts with Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep (Tested Reactivity: Human) and may cross-react with other species as described in the data sheet. AAA Biotech's IL12RB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IL12RB2 il12rb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVWYMKRHID YSRQQISLFW KNLSVSEARG KILHYQVTLQ ELTGGKAMTQ. It is sometimes possible for the material contained within the vial of "IL12RB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.