Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198418_WB10.jpg WB (Western Blot) (WB Suggested Anti-ILF3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: K562 cell lysateILF3 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

Rabbit ILF3 Polyclonal Antibody | anti-ILF3 antibody

ILF3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ILF3; CBTF; DRBF; MMP4; MPP4; NF90; NFAR; NF110; NF90a; NF90b; NFAR2; TCP80; DRBP76; NF110b; NFAR-1; TCP110; MPHOSPH4; NF-AT-90
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ILF3, Antibody; ILF3 antibody - N-terminal region; anti-ILF3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Specificity
The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (702aa, 76kDa), 3 (764aa, 83kDa), 4 (698aa, 76kDa) and 5 (690aa, 75kDa), 6 (706aa, 77kDa) and 7 (898aa, 96kDa) of human ILF3.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKG
Sequence Length
894
Applicable Applications for anti-ILF3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ILF3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: K562 cell lysateILF3 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

product-image-AAA198418_WB10.jpg WB (Western Blot) (WB Suggested Anti-ILF3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: K562 cell lysateILF3 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

WB (Western Blot)

(WB Suggested Anti-ILF3 AntibodyTitration: 1 ug/mlPositive Control: Rat tissue)

product-image-AAA198418_WB11.jpg WB (Western Blot) (WB Suggested Anti-ILF3 AntibodyTitration: 1 ug/mlPositive Control: Rat tissue)

WB (Western Blot)

(Host: RabbitTarget Name: ILF3Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA198418_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ILF3Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Human Lung)

product-image-AAA198418_IHC15.jpg IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-ILF3 antibody
This is a rabbit polyclonal antibody against ILF3. It was validated on Western Blot and immunohistochemistry

Target Description: Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of ILF3.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
interleukin enhancer-binding factor 3 isoform b
NCBI Official Synonym Full Names
interleukin enhancer binding factor 3
NCBI Official Symbol
ILF3
NCBI Official Synonym Symbols
CBTF; DRBF; MMP4; MPP4; NF90; NFAR; NF110; NF90a; NF90b; NFAR2; TCP80; DRBP76; NF110b; NFAR-1; TCP110; MPHOSPH4; NF-AT-90
NCBI Protein Information
interleukin enhancer-binding factor 3
UniProt Protein Name
Interleukin enhancer-binding factor 3
UniProt Gene Name
ILF3
UniProt Synonym Gene Names
DRBF; MPHOSPH4; NF90; DRBP76; MPP4; NFAR; NF-AT-90; TCP80
UniProt Entry Name
ILF3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ILF3 ilf3 (Catalog #AAA198418) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ILF3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ILF3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ILF3 ilf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IFVNDDRHVM AKHSSVYPTQ EELEAVQNMV SHTERALKAV SDWIDEQEKG. It is sometimes possible for the material contained within the vial of "ILF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.