Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198690_WB11.jpg WB (Western Blot) (WB Suggested Anti-ILF3 Antibody Titration: 0.0625ug/mlPositive Control: Raji cell lysateThere is BioGPS gene expression data showing that ILF3 is expressed in Raji)

Rabbit ILF3 Polyclonal Antibody | anti-ILF3 antibody

ILF3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ILF3; CBTF; DRBF; MMP4; MPP4; NF90; NFAR; NF110; NF90a; NF90b; NFAR2; TCP80; DRBP76; NF110b; NFAR-1; TCP110; MPHOSPH4; NF-AT-90
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ILF3, Antibody; ILF3 antibody - N-terminal region; anti-ILF3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD
Sequence Length
702
Applicable Applications for anti-ILF3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Rabbit: 85%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ILF3 Antibody Titration: 0.0625ug/mlPositive Control: Raji cell lysateThere is BioGPS gene expression data showing that ILF3 is expressed in Raji)

product-image-AAA198690_WB11.jpg WB (Western Blot) (WB Suggested Anti-ILF3 Antibody Titration: 0.0625ug/mlPositive Control: Raji cell lysateThere is BioGPS gene expression data showing that ILF3 is expressed in Raji)

IHC (Immunohiostchemistry)

(Rabbit Anti-ILF3 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198690_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-ILF3 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-ILF3 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198690_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ILF3 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ILF3 antibody
This is a rabbit polyclonal antibody against ILF3. It was validated on Western Blot and immunohistochemistry

Target Description: ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity. ILF3 may regulate transcription of the IL2 gene during T-cell activation. It can promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
interleukin enhancer-binding factor 3 isoform b
NCBI Official Synonym Full Names
interleukin enhancer binding factor 3
NCBI Official Symbol
ILF3
NCBI Official Synonym Symbols
CBTF; DRBF; MMP4; MPP4; NF90; NFAR; NF110; NF90a; NF90b; NFAR2; TCP80; DRBP76; NF110b; NFAR-1; TCP110; MPHOSPH4; NF-AT-90
NCBI Protein Information
interleukin enhancer-binding factor 3
UniProt Protein Name
Interleukin enhancer-binding factor 3
UniProt Gene Name
ILF3
UniProt Synonym Gene Names
DRBF; MPHOSPH4; NF90; DRBP76; MPP4; NFAR; NF-AT-90; TCP80
UniProt Entry Name
ILF3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ILF3 ilf3 (Catalog #AAA198690) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ILF3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ILF3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ILF3 ilf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTQEELEAVQ NMVSHTERAL KAVSDWIDEQ EKGSSEQAES DNMDVPPEDD. It is sometimes possible for the material contained within the vial of "ILF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.