Rabbit Intestinal FABP Polyclonal Antibody | anti-FABP2 antibody

Anti-Intestinal FABP Antibody

Cat. Num. AAA46616

• Gene Names: FABP2; FABPI; I-FABP
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: Intestinal FABP, Antibody; Anti-Intestinal FABP Antibody; FABP2; FABPI; I FABP; IFABP; I-FABP; intestinal FABP; P12104; Fatty acid-binding protein, intestinal; fatty acid binding protein 2, intestinal; anti-FABP2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized ; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 132

• Applicable Applications for anti-FABP2 antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Intestinal FABP (2-38aa AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Relevant Detection Systems: The lab recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (please inquire) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit ( ) for IHC(P).
• Preparation and Storage: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(FABP2/I-FABP was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- FABP2/I-FABP Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(FABP2/I-FABP was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- FABP2/I-FABP Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(FABP2/I-FABP was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- FABP2/I-FABP Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of FABP2/I-FABP expression in SW620 whole cell lysates (lane 1). FABP2/I-FABP at 15KD was detected using rabbit anti- FABP2/I-FABP Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Related Product Information for anti-FABP2 antibody

Background: FABP 2, Fatty acid-binding protein 2, is a protein that in humans is encoded by the FABP2 gene. Using a human cDNA probe, the gene is assigned to chromosome 4 in somatic cell hybrids. FABP 2 gene contains four exons and is an abundant cytosolic protein in small intestine epithelial cells. The FABPs belong to a multigene family with nearly twenty identified members. And FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. Also, they may be responsible in the modulation of cell growth and proliferation.

References

1. Baier, L. J., Sacchettini, J. C., Knowler, W. C., Eads, J., Paolisso, G., Tataranni, P. A., Mochizuki, H., Bennett, P. H., Bogardus, C., Prochazka, M.An amino acid substitution in the human intestinal fatty acid binding protein is associated with increased fatty acid binding, increased fat oxidation, and insulin resistance.J. Clin. Invest. 95: 1281-1287, 1995.
2. Georgopoulos, A., Aras, O., Tsai, M. Y.Codon-54 polymorphism of the fatty acid-binding protein 2 gene is associated with elevation of fasting and postprandial triglyceride in type 2 diabetes.J. Clin. Endocr. Metab. 85: 3155-3160, 2000.
3. Sparkes, R. S., Mohandas, T., Heinzmann, C., Gordon, J. I., Klisak, I., Zollman, S., Sweetser, D. A., Ragunathan, L., Winokur, S., Lusis, A. J.Human fatty acid binding protein assignments intestinal to 4q28-4q31 and liver to 2p11. (Abstract)Cytogenet. Cell Genet. 46: 697 only, 1987.

NCBI and Uniprot Product Information

• NCBI GI #: 194097325
• NCBI GeneID: 2169
• NCBI Accession #: NP_000125.2
• NCBI GenBank Nucleotide #: NM_000134.3
• UniProt Accession #: P12104; Q2NKJ1
• NCBI Official Full Name: fatty acid-binding protein, intestinal
• NCBI Official Synonym Full Names: fatty acid binding protein 2
• NCBI Official Symbol: FABP2
• NCBI Official Synonym Symbols: FABPI; I-FABP
• NCBI Protein Information: fatty acid-binding protein, intestinal
• UniProt Protein Name: Fatty acid-binding protein, intestinal
• UniProt Gene Name: FABP2
• UniProt Synonym Gene Names: FABPI; I-FABP
• UniProt Entry Name: FABPI_HUMAN