Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28315_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse brain using ITCH antibody at dilution of 1:100 (40x lens).)

Rabbit ITCH Polyclonal Antibody | anti-ITCH antibody

[KO Validated] ITCH Rabbit pAb

Gene Names
ITCH; AIF4; AIP4; NAPP1; dJ468O1.1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
ITCH, Antibody; [KO Validated] ITCH Rabbit pAb; ITCH; ADMFD; AIF4; AIP4; NAPP1; anti-ITCH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
QSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVT
Applicable Applications for anti-ITCH antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Customer Validation: WB: Human
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ITCH (NP_001244066.1).
Positive Samples
293T, THP-1, NIH/3T3, C6, Mouse lung, Mouse kidney, Rat lung, Rat spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using ITCH antibody at dilution of 1:100 (40x lens).)

product-image-AAA28315_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse brain using ITCH antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human placenta using ITCH antibody at dilution of 1:100 (40x lens).)

product-image-AAA28315_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human placenta using ITCH antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using ITCH antibody at dilution of 1:100 (40x lens).)

product-image-AAA28315_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using ITCH antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using ITCH antibody at dilution of 1:100 (40x lens).)

product-image-AAA28315_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using ITCH antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and ITCH knockout (KO) 293T cells, using ITCH antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA28315_WB2.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and ITCH knockout (KO) 293T cells, using ITCH antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ITCH antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA28315_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ITCH antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-ITCH antibody
Background: This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein plays a role in multiple cellular processes including erythroid and lymphoid cell differentiation and the regulation of immune responses. Mutations in this gene are a cause of syndromic multisystem autoimmune disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
102,803 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase Itchy homolog isoform 1
NCBI Official Synonym Full Names
itchy E3 ubiquitin protein ligase
NCBI Official Symbol
ITCH
NCBI Official Synonym Symbols
AIF4; AIP4; NAPP1; dJ468O1.1
NCBI Protein Information
E3 ubiquitin-protein ligase Itchy homolog; NFE2-associated polypeptide 1; atrophin-1 interacting protein 4; itchy E3 ubiquitin protein ligase homolog; dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4))
UniProt Protein Name
E3 ubiquitin-protein ligase Itchy homolog
UniProt Gene Name
ITCH
UniProt Synonym Gene Names
Itch; AIP4; NAPP1
UniProt Entry Name
ITCH_HUMAN

Similar Products

Product Notes

The ITCH itch (Catalog #AAA28315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] ITCH Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ITCH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200 Customer Validation: WB: Human. Researchers should empirically determine the suitability of the ITCH itch for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QSKKTEKCNN TNSPKWKQPL TVIVTPVSKL HFRVWSHQTL KSDVLLGTAA LDIYETLKSN NMKLEEVVVT LQLGGDKEPT ETIGDLSICL DGLQLESEVV T. It is sometimes possible for the material contained within the vial of "ITCH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.