Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse brain using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Rabbit ITCH Polyclonal Antibody | anti-ITCH antibody

ITCH Rabbit pAb

Gene Names
MYL6B; MLC1SA
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
ITCH, Antibody; ITCH Rabbit pAb; ITCH; ADMFD; AIF4; AIP4; NAPP1; anti-ITCH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Applicable Applications for anti-ITCH antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF/ICC: 1:50-1:200
Positive Samples
293T, NIH/3T3, C6, Mouse lung
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-155 of ITCH (NP_001244066.1).
Cellular Location
cell cortex, cytoplasm, cytoplasmic vesicle, cytosol, extracellular exosome, nucleoplasm, plasma membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse brain using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human placenta using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human placenta using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using ITCH antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ITCH antibody at dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ITCH antibody at dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

WB (Western Blot)

(Western blot analysis of extracts of 293T cells, using ITCH antibody at dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

WB (Western Blot) (Western blot analysis of extracts of 293T cells, using ITCH antibody at dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-ITCH antibody
This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein plays a role in multiple cellular processes including erythroid and lymphoid cell differentiation and the regulation of immune responses. Mutations in this gene are a cause of syndromic multisystem autoimmune disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,764 Da
NCBI Official Full Name
myosin light chain 6B
NCBI Official Synonym Full Names
myosin, light chain 6B, alkali, smooth muscle and non-muscle
NCBI Official Symbol
MYL6B
NCBI Official Synonym Symbols
MLC1SA
NCBI Protein Information
myosin light chain 6B; myosin alkali light chain 1 slow a; myosin light chain 1 slow a; myosin light chain 1 slow-twitch muscle A isoform; myosin light chain 1, slow-twitch muscle A isoform; myosin, light polypeptide 6B, alkali, smooth muscle and non-musc
UniProt Protein Name
Myosin light chain 6B
UniProt Gene Name
MYL6B
UniProt Synonym Gene Names
MLC1SA; MLC1sa
UniProt Entry Name
MYL6B_HUMAN

Similar Products

Product Notes

The ITCH myl6b (Catalog #AAA28409) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITCH Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ITCH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC). WB: 1:500-1:2000 IHC: 1:50-1:100 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the ITCH myl6b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPPKKDVPVK KPAGPSISKP AAKPAAAGAP PAKTKAEPAV PQAPQKTQEP PVDLSKVVIE FNKDQLEEFK EAFELFDRVG DGKILYSQCG DVMRALGQNP TNAEVLKVLG NPKSDELKSR RVDFETFLPM LQAVAKNRGQ GTYEDYLEGF RVFDKEGNGK VMGAELRHVL TTLGEKMTEE EVETVLAGHE DSNGCINYEA FLKHILSV. It is sometimes possible for the material contained within the vial of "ITCH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.