Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201275_WB13.jpg WB (Western Blot) (WB Suggested Anti-ITGA2 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellITGA2 is supported by BioGPS gene expression data to be expressed in HT1080)

Rabbit ITGA2 Polyclonal Antibody | anti-ITGA2 antibody

ITGA2 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
ITGA2; BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2
Reactivity
Reacts with : Human
Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
ITGA2, Antibody; ITGA2 Antibody - C-terminal region; UBC; PDIA3; ATF2; ALB; ERGIC1; SHARPIN; ITGB1; PSMD4; AUP1; ITGA2; LAMA1; CD9; HSPG2; MMP1; COL8A1; COL1A2; COL1A1; ACTA1; RABIF; CD46; anti-ITGA2 antibody
Ordering
Host
Rabbit
Reactivity
Reacts with : Human
Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Lot dependent within range: 100 ul at 0.5-1 mg/ml "Please refer to the vial's label." (varies by lot)
Sequence
Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF
Sequence Length
1181
Applicable Applications for anti-ITGA2 antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Cow: 92%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITGA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ITGA2 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellITGA2 is supported by BioGPS gene expression data to be expressed in HT1080)

product-image-AAA201275_WB13.jpg WB (Western Blot) (WB Suggested Anti-ITGA2 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellITGA2 is supported by BioGPS gene expression data to be expressed in HT1080)

IF (Immunofluorescence)

(Sample Type :HeLa cellsPrimary Antibody Dilution :1:150Secondary Antibody :Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:800Color/Signal Descriptions :Green: ITGA2Blue: DAPIGene Name :ITGA2Submitted by :COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit)

product-image-AAA201275_IF15.jpg IF (Immunofluorescence) (Sample Type :HeLa cellsPrimary Antibody Dilution :1:150Secondary Antibody :Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:800Color/Signal Descriptions :Green: ITGA2Blue: DAPIGene Name :ITGA2Submitted by :COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit)
Related Product Information for anti-ITGA2 antibody
This is a rabbit polyclonal antibody against ITGA2. It was validated on Western Blot

Target Description: This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling.
Product Categories/Family for anti-ITGA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126kDa
NCBI Official Full Name
integrin alpha-2
NCBI Official Synonym Full Names
integrin subunit alpha 2
NCBI Official Symbol
ITGA2
NCBI Official Synonym Symbols
BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2
NCBI Protein Information
integrin alpha-2
UniProt Protein Name
Integrin alpha-2
UniProt Gene Name
ITGA2
UniProt Synonym Gene Names
CD49B; GPIa
UniProt Entry Name
ITA2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ITGA2 itga2 (Catalog #AAA201275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGA2 Antibody - C-terminal region reacts with Reacts with : Human Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the ITGA2 itga2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQNLQNQASL SFQALSESQE ENKADNLVNL KIPLLYDAEI HLTRSTNINF. It is sometimes possible for the material contained within the vial of "ITGA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.