Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46335_IHC10.jpg IHC (Immunohistochemistry) (Anti- KCNIP2 Picoband antibody, AAA46335,IHC(P)IHC(P): Rat Brain Tissue)

KChIP2 Polyclonal Antibody | anti-KChIP2 antibody

Anti-KChIP2 Antibody

Average rating 0.0
No ratings yet
Gene Names
KCNIP2; KCHIP2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
KChIP2, Antibody; Anti-KChIP2 Antibody; Kv channel-interacting protein 2; A type potassium channel modulatory protein 2; A-type potassium channel modulatory protein 2; Cardiac voltage gated potassium channel modulatory subunit; Cardiac voltage-gated potassium channel modulatory subunit; DKFZp566L1246; KChIP 2; KChIP2; KCIP2_HUMAN; KCNIP 2; Kcnip2; Kv channel interacting protein 2; MGC17241; Potassium channel interacting protein 2; Potassium channel-interacting protein 2; anti-KChIP2 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
285
Applicable Applications for anti-KChIP2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- KCNIP2 Picoband antibody, AAA46335,IHC(P)IHC(P): Rat Brain Tissue)

product-image-AAA46335_IHC10.jpg IHC (Immunohistochemistry) (Anti- KCNIP2 Picoband antibody, AAA46335,IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohistochemisry)

(Anti- KCNIP2 Picoband antibody, AAA46335,IHC(P)IHC(P): Human Glioma Tissue)

product-image-AAA46335_IHC11.jpg IHC (Immunohistochemisry) (Anti- KCNIP2 Picoband antibody, AAA46335,IHC(P)IHC(P): Human Glioma Tissue)

IHC (Immunohiostchemistry)

(Anti- KCNIP2 Picoband antibody, AAA46335,IHC(P)IHC(P): Mouse Brain Tissue)

product-image-AAA46335_IHC13.jpg IHC (Immunohiostchemistry) (Anti- KCNIP2 Picoband antibody, AAA46335,IHC(P)IHC(P): Mouse Brain Tissue)

WB (Western Blot)

(Anti- KCNIP2 Picoband antibody, AAA46335, Western blottingAll lanes: Anti KCNIP2 (AAA46335) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 4: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD)

product-image-AAA46335_WB15.jpg WB (Western Blot) (Anti- KCNIP2 Picoband antibody, AAA46335, Western blottingAll lanes: Anti KCNIP2 (AAA46335) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 4: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD)
Related Product Information for anti-KChIP2 antibody
Description: Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.
References
1. An WF, Bowlby MR, Betty M, Cao J, Ling HP, Mendoza G, Hinson JW, Mattsson KI, Strassle BW, Trimmer JS, Rhodes KJ (Feb 2000). "Modulation of A-type potassium channels by a family of calcium sensors". Nature 403(6769): 553-6. 2. Burgoyne RD (2007). "Neuronal calcium sensor proteins: generating diversity in neuronal Ca2+ signalling". Nat. Rev. Neurosci. 8 (3): 182-93.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,401 Da
NCBI Official Full Name
Kv channel-interacting protein 2 isoform 1
NCBI Official Synonym Full Names
potassium voltage-gated channel interacting protein 2
NCBI Official Symbol
KCNIP2
NCBI Official Synonym Symbols
KCHIP2
NCBI Protein Information
Kv channel-interacting protein 2
UniProt Protein Name
Kv channel-interacting protein 2
UniProt Gene Name
KCNIP2
UniProt Synonym Gene Names
KCHIP2; KChIP2
UniProt Entry Name
KCIP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KChIP2 kcnip2 (Catalog #AAA46335) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-KChIP2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KChIP2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KChIP2 kcnip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KChIP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.