Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197978_WB11.jpg WB (Western Blot) (WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mLSample Type: Human HepG2)

Rabbit KCNAB2 Polyclonal Antibody | anti-KCNAB2 antibody

KCNAB2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
KCNAB2; AKR6A5; KCNA2B; HKvbeta2; KV-BETA-2; HKvbeta2.1; HKvbeta2.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KCNAB2, Antibody; KCNAB2 antibody - middle region; anti-KCNAB2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYRS
Sequence Length
353
Applicable Applications for anti-KCNAB2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mLSample Type: Human HepG2)

product-image-AAA197978_WB11.jpg WB (Western Blot) (WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mLSample Type: Human HepG2)

WB (Western Blot)

(WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysateKCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA197978_WB13.jpg WB (Western Blot) (WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Jurkat cell lysateKCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

IHC (Immunohistochemistry)

(Rabbit Anti-KCNAB2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA197978_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-KCNAB2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-KCNAB2 antibody
This is a rabbit polyclonal antibody against KCNAB2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.
Product Categories/Family for anti-KCNAB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
voltage-gated potassium channel subunit beta-2 isoform 2
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily A regulatory beta subunit 2
NCBI Official Symbol
KCNAB2
NCBI Official Synonym Symbols
AKR6A5; KCNA2B; HKvbeta2; KV-BETA-2; HKvbeta2.1; HKvbeta2.2
NCBI Protein Information
voltage-gated potassium channel subunit beta-2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KCNAB2 (Catalog #AAA197978) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNAB2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KCNAB2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KCNAB2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSVLLGASNA DQLMENIGAI QVLPKLSSSI IHEIDSILGN KPYSKKDYRS. It is sometimes possible for the material contained within the vial of "KCNAB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.