Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197981_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNG1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit KCNG1 Polyclonal Antibody | anti-KCNG1 antibody

KCNG1 antibody - N-terminal region

Gene Names
KCNG1; K13; kH2; KCNG; KV6.1
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNG1, Antibody; KCNG1 antibody - N-terminal region; anti-KCNG1 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA
Sequence Length
513
Applicable Applications for anti-KCNG1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: KCNG1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197981_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNG1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNG1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA197981_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: KCNG1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(WB Suggested Anti-KCNG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)

product-image-AAA197981_WB15.jpg WB (Western Blot) (WB Suggested Anti-KCNG1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysate)
Related Product Information for anti-KCNG1 antibody
This is a rabbit polyclonal antibody against KCNG1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Alternative splicing results in at least two transcript variants encoding distinct isoforms. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal and cancerous tissues.
Product Categories/Family for anti-KCNG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily G member 1
NCBI Official Synonym Full Names
potassium voltage-gated channel modifier subfamily G member 1
NCBI Official Symbol
KCNG1
NCBI Official Synonym Symbols
K13; kH2; KCNG; KV6.1
NCBI Protein Information
potassium voltage-gated channel subfamily G member 1
UniProt Protein Name
Potassium voltage-gated channel subfamily G member 1
UniProt Gene Name
KCNG1
UniProt Entry Name
KCNG1_HUMAN

Similar Products

Product Notes

The KCNG1 kcng1 (Catalog #AAA197981) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNG1 antibody - N-terminal region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNG1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KCNG1 kcng1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDVTCNEFFF DRNPGAFGTI LTFLRAGKLR LLREMCALSF QEELLYWGIA. It is sometimes possible for the material contained within the vial of "KCNG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.