Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit KCNJ12 Polyclonal Antibody | anti-KCNJ12 antibody

KCNJ12 antibody - middle region

Gene Names
KCNJ12; IRK2; hIRK; IRK-2; hIRK1; KCNJN1; Kir2.2; Kir2.2v; kcnj12x; hkir2.2x
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNJ12, Antibody; KCNJ12 antibody - middle region; anti-KCNJ12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR
Sequence Length
433
Applicable Applications for anti-KCNJ12 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNJ12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

WB (Western Blot) (WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal StomachAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal StomachAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal PancreasAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal PancreasAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: KCNJ12Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KCNJ12Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: KCNJ12Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-KCNJ12 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscleObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry) (Rabbit Anti-KCNJ12 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscleObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-KCNJ12 antibody
This is a rabbit polyclonal antibody against KCNJ12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KCNJ12 is an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). This gene is located within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-486 BC027982.1 12-497 487-488 AC068418.5 101651-101652 489-2455 BC027982.1 500-2466 2456-2483 DA115102.1 132-159 2484-2485 AC068418.5 141899-141900 2486-2889 DA115102.1 161-564 2890-3454 BM799671.1 118-682 3455-3457 AC068418.5 142870-142872 3458-4692 AK024229.1 926-2160 4693-5230 AK024229.1 2163-2700
Product Categories/Family for anti-KCNJ12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 12
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily J member 12
NCBI Official Symbol
KCNJ12
NCBI Official Synonym Symbols
IRK2; hIRK; IRK-2; hIRK1; KCNJN1; Kir2.2; Kir2.2v; kcnj12x; hkir2.2x
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 12
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 12
UniProt Gene Name
KCNJ12
UniProt Synonym Gene Names
IRK2; KCNJN1; IRK-2
UniProt Entry Name
KCJ12_HUMAN

Similar Products

Product Notes

The KCNJ12 kcnj12 (Catalog #AAA23443) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNJ12 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNJ12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNJ12 kcnj12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDLVENKFLL PSANSFCYEN ELAFLSRDEE DEADGDQDGR SRDGLSPQAR. It is sometimes possible for the material contained within the vial of "KCNJ12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.