WB (Western Blot)
(Western blot analysis of lysates from 293T cells using [KD Validated] KDM2B Rabbit pAb (AAA283319) at 1:1000 dilution incubated overnight at 4°C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020)Exposure time: 90 s.)
Rabbit anti-Human KDM2B Polyclonal Antibody | anti-KDM2B antibody
[KD Validated] KDM2B Rabbit pAb
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
KDM2B, Antibody; [KD Validated] KDM2B Rabbit pAb; CXXC2; Fbl10; PCCX2; FBXL10; JHDM1B; anti-KDM2B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
DGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTRIDLNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLSDCNKVTDQCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKLS
Applicable Applications for anti-KDM2B antibody
ELISA, WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1059-1336 of human KDM2B (NP_115979.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of lysates from 293T cells using [KD Validated] KDM2B Rabbit pAb (AAA283319) at 1:1000 dilution incubated overnight at 4°C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020)Exposure time: 90 s.)
WB (Western Blot)
(Western blot analysis of lysates from 293T cells using [KD Validated] KDM2B Rabbit pAb (AAA283319) at 1:1000 dilution incubated overnight at 4°C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020)Exposure time: 90 s.)
WB (Western Blot)
(Western blot analysis of lysates from Hep G2 cells using [KD Validated] KDM2B Rabbit pAb (AAA283319) at 1:1000 dilution incubated overnight at 4°C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020)Exposure time: 90 s.)
WB (Western Blot)
(Western blot analysis of lysates from Hep G2 cells using [KD Validated] KDM2B Rabbit pAb (AAA283319) at 1:1000 dilution incubated overnight at 4°C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020)Exposure time: 90 s.)
Related Product Information for anti-KDM2B antibody
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.
Product Categories/Family for anti-KDM2B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 153kDa
Observed MW: 180kDa
Observed MW: 180kDa
UniProt Protein Name
Lysine-specific demethylase 2B
UniProt Gene Name
KDM2B
UniProt Synonym Gene Names
CXXC2; FBL10; FBXL10; JHDM1B; PCCX2; Protein JEMMA
UniProt Entry Name
KDM2B_HUMAN
Similar Products
Product Notes
The KDM2B kdm2b (Catalog #AAA283319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] KDM2B Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KDM2B can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the KDM2B kdm2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DGAAHVMHRE VWMAVFSYLS HQDLCVCMRV CRTWNRWCCD KRLWTRIDLN HCKSITPLML SGIIRRQPVS LDLSWTNISK KQLSWLINRL PGLRDLVLSG CSWIAVSALC SSSCPLLRTL DVQWVEGLKD AQMRDLLSPP TDNRPGQMDN RSKLRNIVEL RLAGLDITDA SLRLIIRHMP LLSKLHLSYC NHVTDQSINL LTAVGTTTRD SLTEINLSDC NKVTDQCLSF FKRCGNICHI DLRYCKQVTK EGCEQFIAEM SVSVQFGQVE EKLLQKLS. It is sometimes possible for the material contained within the vial of "KDM2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.