Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283264_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit anti-Human KDM7A Polyclonal Antibody | anti-KDM7A antibody

KDM7A Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Affinity purification
Synonyms
KDM7A, Antibody; KDM7A Rabbit pAb; JHDM1D; KDM7A; anti-KDM7A antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
VQSRNYVDSSGSSLQNGKYMQNSNLTSGACQISNGSLSPERPVGETSFSVPLHPTKRPASNPPPISNQATKGKRPKKGMATAKQRLGKILKLNRNGHARFFV
Applicable Applications for anti-KDM7A antibody
ELISA, IHC (Immunohistochemistry)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 840-941 of human KDM7A(NP_085150.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283264_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283264_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283264_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA283264_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using KDM7A Rabbit pAb (AAA283264) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
Related Product Information for anti-KDM7A antibody
Enables histone demethylase activity; methylated histone binding activity; and transition metal ion binding activity. Involved in histone lysine demethylation. Located in nucleolus and nucleoplasm. Implicated in melanoma.
Product Categories/Family for anti-KDM7A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 106kDa
UniProt Protein Name
Lysine-specific demethylase 7
UniProt Gene Name
JHDM1D
UniProt Synonym Gene Names
KDM7; KIAA1718
UniProt Entry Name
KDM7_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KDM7A jhdm1d (Catalog #AAA283264) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KDM7A Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KDM7A can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KDM7A jhdm1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VQSRNYVDSS GSSLQNGKYM QNSNLTSGAC QISNGSLSPE RPVGETSFSV PLHPTKRPAS NPPPISNQAT KGKRPKKGMA TAKQRLGKIL KLNRNGHARF FV. It is sometimes possible for the material contained within the vial of "KDM7A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.