Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA132381_IHC10.jpg IHC (Immunohistochemistry) (DAB staining on IHC-P; Samples: Human Kidney Tissue))

Rabbit Keratin 17 (KRT17) Polyclonal Antibody | anti-KRT17 antibody

Polyclonal Antibody to Keratin 17 (KRT17)

Gene Names
KRT17; PC; K17; PC2; 39.1; CK-17; PCHC1
Reactivity
Human, Mouse, Rat, Pig
Applications
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry
Purity
Affinity Chromatography
Synonyms
Keratin 17 (KRT17), Antibody; Polyclonal Antibody to Keratin 17 (KRT17); anti-KRT17 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Pig
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against KRT17. It has been selected for its ability to recognize KRT17 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
1mg/ml (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-ILNEMRDQY EKMAEKNRKD AEDWFFSKTE ELNREVATNS ELVQSGKSEI SELRRTMQAL EIELQSQLSM KASLEGNLAE TENRYCVQLS QIQGLIGSVE EQLAQLRCEM EQQNQEYKIL LDVKTRLEQE IATYRRLLEG EDA
Sequence Length
432
Applicable Applications for anti-KRT17 antibody
WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry)
Immunogen
Recombinant KRT17 (Ile252~Ala393) expressed in E.coli.
Cross Reactivity
Human, Rat, Pig
Conjugated Antibody
The APC conjugated antibody version of this item is also available as
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

IHC (Immunohistochemistry)

(DAB staining on IHC-P; Samples: Human Kidney Tissue))

product-image-AAA132381_IHC10.jpg IHC (Immunohistochemistry) (DAB staining on IHC-P; Samples: Human Kidney Tissue))

IHC (Immunohistochemisry)

(DAB staining on fromalin fixed paraffin- embedded kidney tissue))

product-image-AAA132381_IHC11.jpg IHC (Immunohistochemisry) (DAB staining on fromalin fixed paraffin- embedded kidney tissue))

WB (Western Blot)

(Western Blot: Sample: Recombinant protein.)

product-image-AAA132381_WB13.jpg WB (Western Blot) (Western Blot: Sample: Recombinant protein.)

WB (Western Blot)

(Western Blot: Sample: Porcine Skin lysate; Primary Ab: 1ug/ml Rabbit Anti-Human KRT17 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody)

product-image-AAA132381_WB15.jpg WB (Western Blot) (Western Blot: Sample: Porcine Skin lysate; Primary Ab: 1ug/ml Rabbit Anti-Human KRT17 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,106 Da
NCBI Official Full Name
keratin, type I cytoskeletal 17
NCBI Official Synonym Full Names
keratin 17
NCBI Official Symbol
KRT17
NCBI Official Synonym Symbols
PC; K17; PC2; 39.1; CK-17; PCHC1
NCBI Protein Information
keratin, type I cytoskeletal 17
UniProt Protein Name
Keratin, type I cytoskeletal 17
UniProt Gene Name
KRT17
UniProt Synonym Gene Names
CK-17; K17

Similar Products

Product Notes

The KRT17 krt17 (Catalog #AAA132381) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Keratin 17 (KRT17) reacts with Human, Mouse, Rat, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's Keratin 17 (KRT17) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry). Researchers should empirically determine the suitability of the KRT17 krt17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-ILNEMRD QY EKMAEKNRKD AEDWFFSKTE ELNREVATNS ELVQSGKSEI SELRRTMQAL EIELQSQLSM KASLEGNLAE TENRYCVQLS QIQGLIGSVE EQLAQLRCEM EQQNQEYKIL LDVKTRLEQE IATYRRLLEG EDA. It is sometimes possible for the material contained within the vial of "Keratin 17 (KRT17), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.