Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198734_WB13.jpg WB (Western Blot) (WB Suggested Anti-KHDRBS1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)

Rabbit KHDRBS1 Polyclonal Antibody | anti-KHDRBS1 antibody

KHDRBS1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KHDRBS1; p62; p68; Sam68
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KHDRBS1, Antibody; KHDRBS1 antibody - N-terminal region; anti-KHDRBS1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN
Sequence Length
443
Applicable Applications for anti-KHDRBS1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KHDRBS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KHDRBS1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)

product-image-AAA198734_WB13.jpg WB (Western Blot) (WB Suggested Anti-KHDRBS1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)

IHC (Immunohistochemistry)

(Rabbit Anti-KHDRBS1 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198734_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-KHDRBS1 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-KHDRBS1 antibody
This is a rabbit polyclonal antibody against KHDRBS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
KH domain-containing, RNA-binding, signal transduction-associated protein 1 isoform 1
NCBI Official Synonym Full Names
KH RNA binding domain containing, signal transduction associated 1
NCBI Official Symbol
KHDRBS1
NCBI Official Synonym Symbols
p62; p68; Sam68
NCBI Protein Information
KH domain-containing, RNA-binding, signal transduction-associated protein 1
UniProt Protein Name
KH domain-containing, RNA-binding, signal transduction-associated protein 1
UniProt Gene Name
KHDRBS1
UniProt Synonym Gene Names
Sam68
UniProt Entry Name
KHDR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KHDRBS1 khdrbs1 (Catalog #AAA198734) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KHDRBS1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KHDRBS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KHDRBS1 khdrbs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPELMAEKDS LDPSFTHAMQ LLTAEIEKIQ KGDSKKDDEE NYLDLFSHKN. It is sometimes possible for the material contained within the vial of "KHDRBS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.