Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200466_WB13.jpg WB (Western Blot) (WB Suggested Anti-KIFAP3 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Rabbit KIFAP3 Polyclonal Antibody | anti-KIFAP3 antibody

KIFAP3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
KIFAP3; FLA3; KAP3; SMAP; KAP-1; KAP-3; Smg-GDS; dJ190I16.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KIFAP3, Antibody; KIFAP3 antibody - middle region; anti-KIFAP3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
Sequence Length
792
Applicable Applications for anti-KIFAP3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KIFAP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KIFAP3 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

product-image-AAA200466_WB13.jpg WB (Western Blot) (WB Suggested Anti-KIFAP3 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: KIFAP3Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200466_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: KIFAP3Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KIFAP3 antibody
This is a rabbit polyclonal antibody against KIFAP3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes. The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein.
Product Categories/Family for anti-KIFAP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
kinesin-associated protein 3 isoform 1
NCBI Official Synonym Full Names
kinesin associated protein 3
NCBI Official Symbol
KIFAP3
NCBI Official Synonym Symbols
FLA3; KAP3; SMAP; KAP-1; KAP-3; Smg-GDS; dJ190I16.1
NCBI Protein Information
kinesin-associated protein 3
UniProt Protein Name
Kinesin-associated protein 3
UniProt Gene Name
KIFAP3
UniProt Synonym Gene Names
KIF3AP; SMAP; KAP-3; KAP3
UniProt Entry Name
KIFA3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KIFAP3 kifap3 (Catalog #AAA200466) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIFAP3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIFAP3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KIFAP3 kifap3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WLEMVESRQM DESEQYLYGD DRIEPYIHEG DILERPDLFY NSDGLIASEG. It is sometimes possible for the material contained within the vial of "KIFAP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.