Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201203_WB11.jpg WB (Western Blot) (WB Suggested Anti-KIR2DL1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit anti-Human KIR2DL1 Polyclonal Antibody | anti-KIR2DL1 antibody

KIR2DL1 antibody - C-terminal region

Gene Names
KIR2DL1; NKAT; NKAT1; p58.1; CD158A; KIR221; NKAT-1; KIR-K64; KIR2DL3
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Affinity Purified
Synonyms
KIR2DL1, Antibody; KIR2DL1 antibody - C-terminal region; anti-KIR2DL1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRS
Sequence Length
348
Applicable Applications for anti-KIR2DL1 antibody
WB (Western Blot), IP (Immunoprecipitation)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KIR2DL1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

product-image-AAA201203_WB11.jpg WB (Western Blot) (WB Suggested Anti-KIR2DL1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

IP (Immunoprecipitation)

(Sample Type: 2x107 KIR3DL1 transfected NKLAmount and Sample Type :Lane 1: 2x107 KIR3DL1 transfected NKL cells IP Antibody :KIR2DL1 Amount of IP Antibody :Primary Antibody :KIR2DL1 Primary Antibody Dilution:1:250 Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution:1:10,000 Gene Name :KIR2DL1 Submitted by:Kerry S. Campbell, Institute for Cancer Research.)

product-image-AAA201203_IP13.jpg IP (Immunoprecipitation) (Sample Type: 2x107 KIR3DL1 transfected NKLAmount and Sample Type :Lane 1: 2x107 KIR3DL1 transfected NKL cells IP Antibody :KIR2DL1 Amount of IP Antibody :Primary Antibody :KIR2DL1 Primary Antibody Dilution:1:250 Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution:1:10,000 Gene Name :KIR2DL1 Submitted by:Kerry S. Campbell, Institute for Cancer Research.)

IP (Immunoprecipitation)

(Sample Type: 2x107 KIR2DL1 transfected NKLAmount and Sample Type :Lane 1: 2x107 KIR2DL1 transfected NKL cells IP Antibody :KIR2DL1 Amount of IP Antibody :Primary Antibody :KIR2DL1 Primary Antibody Dilution:1:250 Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution:1:10,000 Gene Name :KIR2DL1 Submitted by:Kerry S. Campbell, Institute for Cancer Research.)

product-image-AAA201203_IP15.jpg IP (Immunoprecipitation) (Sample Type: 2x107 KIR2DL1 transfected NKLAmount and Sample Type :Lane 1: 2x107 KIR2DL1 transfected NKL cells IP Antibody :KIR2DL1 Amount of IP Antibody :Primary Antibody :KIR2DL1 Primary Antibody Dilution:1:250 Secondary Antibody :Anti-rabbit-HRP Secondary Antibody Dilution:1:10,000 Gene Name :KIR2DL1 Submitted by:Kerry S. Campbell, Institute for Cancer Research.)
Related Product Information for anti-KIR2DL1 antibody
This is a rabbit polyclonal antibody against KIR2DL1. It was validated on Western Blot

Target Description: Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
Product Categories/Family for anti-KIR2DL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
killer cell immunoglobulin-like receptor 2DL1
NCBI Official Synonym Full Names
killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
NCBI Official Symbol
KIR2DL1
NCBI Official Synonym Symbols
NKAT; NKAT1; p58.1; CD158A; KIR221; NKAT-1; KIR-K64; KIR2DL3
NCBI Protein Information
killer cell immunoglobulin-like receptor 2DL1
UniProt Protein Name
Killer cell immunoglobulin-like receptor 2DL1
UniProt Gene Name
KIR2DL1
UniProt Synonym Gene Names
CD158A; NKAT1; NKAT-1; p58 NK receptor CL-42/47.11
UniProt Entry Name
KI2L1_HUMAN

Similar Products

Product Notes

The KIR2DL1 kir2dl1 (Catalog #AAA201203) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIR2DL1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIR2DL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation). Researchers should empirically determine the suitability of the KIR2DL1 kir2dl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEQDPQEVTY TQLNHCVFTQ RKITRPSQRP KTPPTDIIVY TELPNAESRS. It is sometimes possible for the material contained within the vial of "KIR2DL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.