Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200397_WB8.jpg WB (Western Blot) (WB Suggested Anti-KPNA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate.KPNA3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit KPNA3 Polyclonal Antibody | anti-KPNA3 antibody

KPNA3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
KPNA3; SRP1; SRP4; IPOA4; hSRP1; SRP1gamma
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KPNA3, Antibody; KPNA3 antibody - N-terminal region; anti-KPNA3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV
Sequence Length
521
Applicable Applications for anti-KPNA3 antibody
WB (Western Blot)
Homology
Cow: 77%; Dog: 77%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KPNA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KPNA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate.KPNA3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA200397_WB8.jpg WB (Western Blot) (WB Suggested Anti-KPNA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate.KPNA3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: KPNA3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200397_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: KPNA3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KPNA3Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200397_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: KPNA3Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: KPNA3Sample Type: HepG2Antibody Dilution: 1.0ug/mlKPNA3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA200397_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: KPNA3Sample Type: HepG2Antibody Dilution: 1.0ug/mlKPNA3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Host: RabbitTarget Name: KPNA3Sample Type: HelaAntibody Dilution: 1.0ug/mlKPNA3 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA200397_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: KPNA3Sample Type: HelaAntibody Dilution: 1.0ug/mlKPNA3 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-KPNA3 antibody
This is a rabbit polyclonal antibody against KPNA3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggest that karyopherin alpha-3 may be involved in the nuclear transport system.The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3, encodes a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KPNA2), respectively. The similarities among these proteins suggests that karyopherin alpha-3 may be involved in the nuclear transport system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-KPNA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
importin subunit alpha-4
NCBI Official Synonym Full Names
karyopherin subunit alpha 3
NCBI Official Symbol
KPNA3
NCBI Official Synonym Symbols
SRP1; SRP4; IPOA4; hSRP1; SRP1gamma
NCBI Protein Information
importin subunit alpha-4
UniProt Protein Name
Importin subunit alpha-4
UniProt Gene Name
KPNA3
UniProt Synonym Gene Names
QIP2; Qip2
UniProt Entry Name
IMA4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KPNA3 kpna3 (Catalog #AAA200397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KPNA3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KPNA3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KPNA3 kpna3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AENPSLENHR IKSFKNKGRD VETMRRHRNE VTVELRKNKR DEHLLKKRNV. It is sometimes possible for the material contained within the vial of "KPNA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.