Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199808_WB13.jpg WB (Western Blot) (WB Suggested Anti-KRT23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit KRT23 Polyclonal Antibody | anti-KRT23 antibody

KRT23 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
KRT23; K23; CK23; HAIK1
Reactivity
Dog, Guinea Pig, Horse, Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KRT23, Antibody; KRT23 antibody - middle region; anti-KRT23 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR
Sequence Length
422
Applicable Applications for anti-KRT23 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KRT23
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KRT23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

product-image-AAA199808_WB13.jpg WB (Western Blot) (WB Suggested Anti-KRT23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

IHC (Immunohistochemistry)

(Immunohistochemistry of formalin-fixed, paraffin-embedded human placenta tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA199808_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of formalin-fixed, paraffin-embedded human placenta tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-KRT23 antibody
This is a rabbit polyclonal antibody against KRT23. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KRT23 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains.The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.
Product Categories/Family for anti-KRT23 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
keratin, type I cytoskeletal 23 isoform 1
NCBI Official Synonym Full Names
keratin 23
NCBI Official Symbol
KRT23
NCBI Official Synonym Symbols
K23; CK23; HAIK1
NCBI Protein Information
keratin, type I cytoskeletal 23
UniProt Protein Name
Keratin, type I cytoskeletal 23
UniProt Gene Name
KRT23
UniProt Synonym Gene Names
CK-23; K23
UniProt Entry Name
K1C23_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KRT23 krt23 (Catalog #AAA199808) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT23 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's KRT23 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KRT23 krt23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IKTHLEKEIT TYRRLLEGES EGTREESKSS MKVSATPKIK AITQETINGR. It is sometimes possible for the material contained within the vial of "KRT23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.