Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200877_WB13.jpg WB (Western Blot) (WB Suggested Anti-LAMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that LAMP1 is expressed in HepG2)

Rabbit LAMP1 Polyclonal Antibody | anti-LAMP1 antibody

LAMP1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
LAMP1; LAMPA; CD107a; LGP120
Reactivity
Tested: Human, Mouse
Predicted: Cow, Dog, Human, Mouse, Pig, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
LAMP1, Antibody; LAMP1 antibody - N-terminal region; anti-LAMP1 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human, Mouse
Predicted: Cow, Dog, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY
Sequence Length
355
Applicable Applications for anti-LAMP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Dog: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LAMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that LAMP1 is expressed in HepG2)

product-image-AAA200877_WB13.jpg WB (Western Blot) (WB Suggested Anti-LAMP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that LAMP1 is expressed in HepG2)

IHC (Immunohistochemistry)

(Sample Type :Mouse NLT cellsPrimary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-GFPSecondary Antibody Dilution :1:500Color/Signal Descriptions :Green: Lamp1Gene Name :LAMP1Submitted by :Wen-Cheng Xiong, Email: WXIONG@georgiahealth.edu)

product-image-AAA200877_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Mouse NLT cellsPrimary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-GFPSecondary Antibody Dilution :1:500Color/Signal Descriptions :Green: Lamp1Gene Name :LAMP1Submitted by :Wen-Cheng Xiong, Email: WXIONG@georgiahealth.edu)
Related Product Information for anti-LAMP1 antibody
This is a rabbit polyclonal antibody against LAMP1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.
Product Categories/Family for anti-LAMP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
lysosomal-associated membrane glycoprotein-1, partial
NCBI Official Synonym Full Names
lysosomal associated membrane protein 1
NCBI Official Symbol
LAMP1
NCBI Official Synonym Symbols
LAMPA; CD107a; LGP120
NCBI Protein Information
lysosome-associated membrane glycoprotein 1
UniProt Protein Name
Lysosome-associated membrane glycoprotein 1
UniProt Gene Name
LAMP1
UniProt Synonym Gene Names
LAMP-1
UniProt Entry Name
LAMP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LAMP1 lamp1 (Catalog #AAA200877) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAMP1 antibody - N-terminal region reacts with Tested: Human, Mouse Predicted: Cow, Dog, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LAMP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the LAMP1 lamp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NMTFDLPSDA TVVLNRSSCG KENTSDPSLV IAFGRGHTLT LNFTRNATRY. It is sometimes possible for the material contained within the vial of "LAMP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.