Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281637_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat heart using LATS2 Rabbit pAb at dilution of 1:100 (40x lens).)

Rabbit LATS2 Polyclonal Antibody | anti-LATS2 antibody

LATS2 Rabbit pAb

Gene Names
LATS2; KPM
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
LATS2, Antibody; LATS2 Rabbit pAb; LATS2; KPM; anti-LATS2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQQQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVN
Applicable Applications for anti-LATS2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LATS2 (NP_055387.2).
Cellular Location
Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle pole
Positive Samples
Mouse testis, Rat lung, Rat testis, Rat kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Rat heart using LATS2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281637_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat heart using LATS2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Mouse heart using LATS2 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281637_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Mouse heart using LATS2 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using LATS2 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281637_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using LATS2 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-LATS2 antibody
Background: This gene encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
~98 kDa
NCBI Official Full Name
Homo sapiens large tumor suppressor kinase 2 (LATS2), mRNA
NCBI Official Synonym Full Names
large tumor suppressor kinase 2
NCBI Official Symbol
LATS2
NCBI Official Synonym Symbols
KPM
NCBI Protein Information
serine/threonine-protein kinase LATS2; warts-like kinase; serine/threonine kinase KPM; large tumor suppressor homolog 2; serine/threonine-protein kinase kpm; LATS, large tumor suppressor, homolog 2; kinase phosphorylated during mitosis protein; LATS (larg
UniProt Protein Name
Serine/threonine-protein kinase LATS2
UniProt Gene Name
LATS2
UniProt Synonym Gene Names
KPM
UniProt Entry Name
LATS2_HUMAN

Similar Products

Product Notes

The LATS2 lats2 (Catalog #AAA281637) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LATS2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LATS2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LATS2 lats2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRPKTFPATT YSGNSRQRLQ EIREGLKQPS KSSVQGLPAG PNSDTSLDAK VLGSKDATRQ QQQMRATPKF GPYQKALREI RYSLLPFANE SGTSAAAEVN. It is sometimes possible for the material contained within the vial of "LATS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.